Basic Information | |
---|---|
Taxon OID | 3300013971 Open in IMG/M |
Scaffold ID | Ga0120323_10496 Open in IMG/M |
Source Dataset Name | Human oral microbial communities from various locations - University of British Columbia - SCG24 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of British Columbia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 681 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051214 | Metagenome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120323_104961 | F051214 | AGGAG | MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVIRVFLHDEDITIKPIYIYNNREYQIACEFPR |
⦗Top⦘ |