| Basic Information | |
|---|---|
| Taxon OID | 3300013971 Open in IMG/M |
| Scaffold ID | Ga0120323_10496 Open in IMG/M |
| Source Dataset Name | Human oral microbial communities from various locations - University of British Columbia - SCG24 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of British Columbia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 681 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051214 | Metagenome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120323_104961 | F051214 | AGGAG | MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVIRVFLHDEDITIKPIYIYNNREYQIACEFPR |
| ⦗Top⦘ |