NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013971

3300013971: Human oral microbial communities from various locations - University of British Columbia - SCG24



Overview

Basic Information
IMG/M Taxon OID3300013971 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118603 | Gp0137812 | Ga0120323
Sample NameHuman oral microbial communities from various locations - University of British Columbia - SCG24
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of British Columbia
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1060009
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine And Human Oral Microbial Communities From Various Locations - University Of British Columbia
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal secretion

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051214Metagenome144N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0120323_10496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes681Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0120323_10496Ga0120323_104961F051214MPGKIVAHDTHLRIDTEFIELKDCFEAFRRGVEYREKNDVDDILVICNAPDIIEYQLKNGDSFIVTYDPIHRIIVIRVFLHDEDITIKPIYIYNNREYQIACEFPR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.