| Basic Information | |
|---|---|
| Taxon OID | 3300013969 Open in IMG/M |
| Scaffold ID | Ga0120039_10271 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of British Columbia |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 602 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092898 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120039_102711 | F092898 | GAGG | MIEQFQEVEFETRTIGPLVLTAPVLQSPGFRGIVNCYCPIAEQADLDHGLVAELVTQVQNSHSQGFCSV* |
| ⦗Top⦘ |