| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013969 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118603 | Gp0137425 | Ga0120039 |
| Sample Name | Marine microbial communities from various locations - University of British Columbia - seawater enrichment SCG69 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of British Columbia |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 491798 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine And Human Oral Microbial Communities From Various Locations - University Of British Columbia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092898 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120039_10271 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120039_10271 | Ga0120039_102711 | F092898 | MIEQFQEVEFETRTIGPLVLTAPVLQSPGFRGIVNCYCPIAEQADLDHGLVAELVTQVQNSHSQGFCSV* |
| ⦗Top⦘ |