Scaffold Ga0116653_1033002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116653_1033002

Scaffold Ga0116653_1033002

Overview

Basic Information
Taxon OID	3300013947 Open in IMG/M
Scaffold ID	Ga0116653_1033002 Open in IMG/M
Source Dataset Name	Baboon gut microbial communities from fecal samples in Kenya - M13
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Duke University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	770
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)	2.717	Long. (^o)	37.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013656	Metagenome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116653_10330021	F013656	GGA	MSKIYKEPNKSETETTINVLYSENMLSICTNKVDLQKQLNKLIGEPTKEYKIKRSIAGSTWNISLDDKAKIQKIILKANIYSI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.