Scaffold Ga0116653_1000002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116653_1000002

Scaffold Ga0116653_1000002

Overview

Basic Information
Taxon OID	3300013947 Open in IMG/M
Scaffold ID	Ga0116653_1000002 Open in IMG/M
Source Dataset Name	Baboon gut microbial communities from fecal samples in Kenya - M13
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Duke University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	259863
Total Scaffold Genes	265 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	221 (83.40%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)	2.717	Long. (^o)	37.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116653_1000002188	F036964	AGGAG	MDLLRIIFPIMMVVGALGSLVVNIIQKGDWPTSLQWLGAMLLYTALTFRNVRG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.