Scaffold Ga0117795_1013798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117795_1013798

Scaffold Ga0117795_1013798

Overview

Basic Information
Taxon OID	3300013942 Open in IMG/M
Scaffold ID	Ga0117795_1013798 Open in IMG/M
Source Dataset Name	Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 150
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chalmers University of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1268
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117795_10137982	F042936	N/A	MGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGTLTPPYLGKVYFRSRLRGKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.