| Basic Information | |
|---|---|
| Taxon OID | 3300013886 Open in IMG/M |
| Scaffold ID | Ga0181296_102294 Open in IMG/M |
| Source Dataset Name | laboratory microbial enrichments from Reconcavo Basin petroleum reservoir, Newcastle Upon Tyne, UK - 15 gl 40C L1 15gl 40C L1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | UNIVERSIDADE DE SAO PAULO |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2962 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Laboratory Microcosms → Microbial Communities From Methanogenic Microcosms From Oil Petroleum Samples |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newcastle Upon Tyne, United Kingdom | |||||||
| Coordinates | Lat. (o) | 54.97825278 | Long. (o) | -1.61778056 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037272 | Metagenome / Metatranscriptome | 168 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181296_1022944 | F037272 | GAGG | MTVKQIMRIHTAAGTEDIDADRLLIENDEYILFRGDDEVRRVPISDVISEIDSETGEETGDIETVYSRS* |
| ⦗Top⦘ |