| Basic Information | |
|---|---|
| Taxon OID | 3300013833 Open in IMG/M |
| Scaffold ID | Ga0119880_1006473 Open in IMG/M |
| Source Dataset Name | Sewage treatment plant microbial communities from Vermont, USA - CLO_W |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwich University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4290 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Vermont | |||||||
| Coordinates | Lat. (o) | 43.727094 | Long. (o) | -72.425964 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000690 | Metagenome / Metatranscriptome | 935 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119880_10064731 | F000690 | N/A | MRLASLFGPDAIAQAPRAPRLQTEAEVRVVVGLQALTRSVAEIDRLPEQARTRGVAASYDEVTQIVNPNANPESVARRIRGAMWRLTDRSETGCRLTAPAKEAPGKLGELIAIKEGQLWTLAVVRRMQRLQVDEVTVGVEIIARRLVRVLMRSWVAPPDSGRTNTERPFFGLYLPAHPENRQSSHRSLIGPEDKFGSGGMVELDTGNARYLIRFTQTLEQQAGWSWAMFNAVRKLSG* |
| ⦗Top⦘ |