NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120045_100419

Scaffold Ga0120045_100419


Overview

Basic Information
Taxon OID3300013782 Open in IMG/M
Scaffold IDGa0120045_100419 Open in IMG/M
Source Dataset NameMarine microbial communites from Sargasso Sea - Prochlorococcus B258 surface rep 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUCI
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)935
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Prochlorococcus And Synechococcus Communites From Sargasso Sea And California Currents

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007227Metagenome / Metatranscriptome355Y

Sequences

Protein IDFamilyRBSSequence
Ga0120045_1004192F007227N/AMKKLTKEEIGYKTTDKIRKMWLLNPHDHHMLYVRDDGSFYGFTHMKGEDPEEWFWEAHGIQTELFPPDPPKSHKFTQEQLDRAPHHNILEKYYGKDWKPVPQEGLGDHF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.