Scaffold Ga0120045_100189

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120045_100189

Scaffold Ga0120045_100189

Overview

Basic Information
Taxon OID	3300013782 Open in IMG/M
Scaffold ID	Ga0120045_100189 Open in IMG/M
Source Dataset Name	Marine microbial communites from Sargasso Sea - Prochlorococcus B258 surface rep 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	UCI
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1217
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Prochlorococcus And Synechococcus Communites From Sargasso Sea And California Currents

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001416	Metagenome / Metatranscriptome	699	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120045_1001892	F001416	AGGAG	MPLVKKRLFLTAGSTSDQVLAGSTYEYVDPNTVIRVAAAVDTAGTSATADTTMDFTVNNAEFSRNVSVSKLVDGEPFGASENSNYI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.