NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120044_10827

Scaffold Ga0120044_10827


Overview

Basic Information
Taxon OID3300013780 Open in IMG/M
Scaffold IDGa0120044_10827 Open in IMG/M
Source Dataset NameMarine microbial communites from Sargasso Sea - Prochlorococcus B258 80m rep 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUCI
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)766
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Prochlorococcus And Synechococcus Communites From Sargasso Sea And California Currents

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001614Metagenome / Metatranscriptome663Y

Sequences

Protein IDFamilyRBSSequence
Ga0120044_108271F001614N/AMVNFFGTYGGLICGFGGFLTAIAAFLYARARVAEFERATHDLDWQQVSELSLDVAKLKKASQKWQNNMNAQEAVSLKNLKEQALMQSLMQQNGNVQQIRKVEM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.