Scaffold Ga0119887_1001660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119887_1001660

Scaffold Ga0119887_1001660

Overview

Basic Information
Taxon OID	3300013769 Open in IMG/M
Scaffold ID	Ga0119887_1001660 Open in IMG/M
Source Dataset Name	Sewage treatment plant microbial communities from Vermont, USA - Sand_B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwich University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8764
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant → Sewage Treatment Plant Microbial Communities From Vermont, Usa

Source Dataset Sampling Location
Location Name	USA: Vermont
Coordinates	Lat. (^o)	43.727094	Long. (^o)	-72.425964	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013428	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119887_10016607	F013428	N/A	VSGIKVSDGPTEEQRRGIRRTTIVLALVALAIYVAFIASSVIKAQH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.