| Basic Information | |
|---|---|
| Taxon OID | 3300013759 Open in IMG/M |
| Scaffold ID | Ga0119972_1097565 Open in IMG/M |
| Source Dataset Name | Intertidal thrombolitic mat microbial community from Highborne Cay, Bahamas - Thr-A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Florida |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus cobalaminigenes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Intertidal Thrombolitic Mat → Intertidal Thrombolitic Mat Microbial Community From Highborne Cay, Bahamas |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bahamas: Highborne Cay | |||||||
| Coordinates | Lat. (o) | 24.43 | Long. (o) | -76.49 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087322 | Metagenome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119972_10975651 | F087322 | N/A | SCDIYPTSTSVDLQALRFGFVLTLLLVFKMIQAGTGEACFVFFNRRIFLGDDLRAAIDFQA* |
| ⦗Top⦘ |