NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119972_1097565

Scaffold Ga0119972_1097565


Overview

Basic Information
Taxon OID3300013759 Open in IMG/M
Scaffold IDGa0119972_1097565 Open in IMG/M
Source Dataset NameIntertidal thrombolitic mat microbial community from Highborne Cay, Bahamas - Thr-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Florida
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)513
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus cobalaminigenes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Microbialites → Intertidal Thrombolitic Mat → Intertidal Thrombolitic Mat Microbial Community From Highborne Cay, Bahamas

Source Dataset Sampling Location
Location NameBahamas: Highborne Cay
CoordinatesLat. (o)24.43Long. (o)-76.49Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087322Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0119972_10975651F087322N/ASCDIYPTSTSVDLQALRFGFVLTLLLVFKMIQAGTGEACFVFFNRRIFLGDDLRAAIDFQA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.