Basic Information | |
---|---|
Taxon OID | 3300013748 Open in IMG/M |
Scaffold ID | Ga0116840_1015131 Open in IMG/M |
Source Dataset Name | Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S4-Shot-B61-calc |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Oklahoma |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 754 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Dalheim | |||||||
Coordinates | Lat. (o) | 51.565093 | Long. (o) | 8.849015 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033081 | Metagenome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116840_10151311 | F033081 | AGG | MAWLFRRVMPQNTRPTFVWPKLAVEIGNAGYFGRRWLTAVAAVLIAMTIAAVKALLLIPGLDSSVVNLLTRGFATFLPRGWATGTAWTVGVAGVFLIGDFTNYTKQQKFLHSLKATGCGVYDTLLLFALMEEQAFRSGSEKWSWRERARASVCFGLLHITNIWYSLAAGIALSMTGFGFLLVYLWYYRKYRSQVVAT |
⦗Top⦘ |