3300013748: Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S4-Shot-B61-calc

Overview

Basic Information

• IMG/M Taxon OID: 3300013748
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118456 | Gp0134833 | Ga0116840
• Sample Name: Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S4-Shot-B61-calc
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Oklahoma
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 70931852
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus	1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: Germany: Dalheim
• Coordinates
  • Lat. (^o): 51.565093
  • Long. (^o): 8.849015
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033081	Metagenome	178	Y
F051211	Metagenome	144	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0116840_1015131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus	754
Ga0116840_1024074	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria	602

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116840_1015131	Ga0116840_10151311	F033081	MAWLFRRVMPQNTRPTFVWPKLAVEIGNAGYFGRRWLTAVAAVLIAMTIAAVKALLLIPGLDSSVVNLLTRGFATFLPRGWATGTAWTVGVAGVFLIGDFTNYTKQQKFLHSLKATGCGVYDTLLLFALMEEQAFRSGSEKWSWRERARASVCFGLLHITNIWYSLAAGIALSMTGFGFLLVYLWYYRKYRSQVVAT
Ga0116840_1024074	Ga0116840_10240741	F051211	SNEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHILSLRRQRYERHVILRVFIDGSAYDIDPSIDIGLAPTLPIAHWDGTSSTATMASLKHLRVYRPHSLHERILSRLRSKFFRGNPKEFYTAIDKWLADTRTHQSS*