| Basic Information | |
|---|---|
| Taxon OID | 3300013747 Open in IMG/M |
| Scaffold ID | Ga0116837_1008053 Open in IMG/M |
| Source Dataset Name | Oral microbial communities from fossilized dental plaque from Dalheim, Germany - S1-Shot-B61-calc |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Oklahoma |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1002 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Fossilized Dental Plaque → Oral Microbial Communities From Fossilized Dental Plaque From Dalheim, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Dalheim | |||||||
| Coordinates | Lat. (o) | 51.565093 | Long. (o) | 8.849015 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051211 | Metagenome | 144 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116837_10080532 | F051211 | N/A | MKAKKAIRIFEKIRDLPYGTSGSNEVWSCYRKCVLLKQELQHIGITSQLLIGVFDWQDLPIPEHILSLRRQRYERHVILRVFIDGSAYDIDPSIDIGLAPTLPIAHWDGTSSTATMASLKHLRVYRPHSLHERILSRLRSKFFRGNPKEFYTAIDKWLADTRTHQSS* |
| ⦗Top⦘ |