Scaffold Ga0117782_101716

Overview

Basic Information

• Taxon OID: 3300013737
• Scaffold ID: Ga0117782_101716
• Source Dataset Name: Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_DNA_MDA_NLN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Institute of Marine Science
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1255
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Actiniaria → Edwardsiidae → Nematostella → Nematostella vectensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Source Dataset Sampling Location

• Location Name: Australia: Great Barrier Reef
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023524	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117782_1017161	F023524	N/A	KLYIGETRRRLGDRFREHLRDVELNDKDASKHVVRHFNLPNHSKQHMAVYGLSLHLGSSESRKTLEQKFIFQIGTLNPHGINERFSFN*