Basic Information | |
---|---|
Taxon OID | 3300013726 Open in IMG/M |
Scaffold ID | Ga0117822_106481 Open in IMG/M |
Source Dataset Name | Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-1-St-MgMD-nonhuman |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | San Diego State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 867 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: San Diego | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054109 | Metagenome | 140 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117822_1064812 | F054109 | AGGAGG | MVGRPKSKKGTKVHTAFKIYPVDKERAQAMADKLDMSLSAYINKAVLEKVERDEKSEN* |
⦗Top⦘ |