| Basic Information | |
|---|---|
| Taxon OID | 3300013726 Open in IMG/M |
| Scaffold ID | Ga0117822_106481 Open in IMG/M |
| Source Dataset Name | Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-1-St-MgMD-nonhuman |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | San Diego State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 867 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Diego | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054109 | Metagenome | 140 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117822_1064812 | F054109 | AGGAGG | MVGRPKSKKGTKVHTAFKIYPVDKERAQAMADKLDMSLSAYINKAVLEKVERDEKSEN* |
| ⦗Top⦘ |