3300013726: Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-1-St-MgMD-nonhuman

Overview

Basic Information

• IMG/M Taxon OID: 3300013726
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118644 | Gp0137861 | Ga0117822
• Sample Name: Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-1-St-MgMD-nonhuman
• Sequencing Status: Permanent Draft
• Sequencing Center: San Diego State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25513887
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal corpus

Location Information

• Location: USA: San Diego
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054109	Metagenome	140	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0117822_106481	Not Available	867

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0117822_106481	Ga0117822_1064812	F054109	MVGRPKSKKGTKVHTAFKIYPVDKERAQAMADKLDMSLSAYINKAVLEKVERDEKSEN*