Basic Information | |
---|---|
Taxon OID | 3300013674 Open in IMG/M |
Scaffold ID | Ga0117783_107166 Open in IMG/M |
Source Dataset Name | Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_NLN_DNA_SISPA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Australian Institute of Marine Science |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 579 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Australia: Great Barrier Reef | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001120 | Metagenome / Metatranscriptome | 772 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117783_1071662 | F001120 | N/A | MTRKRSAFNFDKTVGGFNITERGVKSFSKSIKLGPFLFTMNARGSGIRGSVGIPGTGLSKRNIKLF* |
⦗Top⦘ |