Scaffold Ga0117783_105467

Overview

Basic Information

• Taxon OID: 3300013674
• Scaffold ID: Ga0117783_105467
• Source Dataset Name: Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_NLN_DNA_SISPA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Institute of Marine Science
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 729
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Source Dataset Sampling Location

• Location Name: Australia: Great Barrier Reef
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050306	Metagenome	145	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117783_1054672	F050306	AGAAG	MIDYLDIKKRKEVTVKKMFEIYKNDNKYRNRITWDAHYLITGWKHIQQTKDEKK*