| Basic Information | |
|---|---|
| Taxon OID | 3300013674 Open in IMG/M |
| Scaffold ID | Ga0117783_101906 Open in IMG/M |
| Source Dataset Name | Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_NLN_DNA_SISPA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Australian Institute of Marine Science |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1333 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Australia: Great Barrier Reef | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044149 | Metagenome / Metatranscriptome | 155 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117783_1019062 | F044149 | N/A | MMDNLETITDPIEEVLELMVKHQLAVVADKKLDLARVIGRLQSQLIKTKETNKNFNEQWKFLHDTHEDLMGQVERIYGV* |
| ⦗Top⦘ |