Scaffold Ga0117783_100798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117783_100798

Scaffold Ga0117783_100798

Overview

Basic Information
Taxon OID	3300013674 Open in IMG/M
Scaffold ID	Ga0117783_100798 Open in IMG/M
Source Dataset Name	Coral viral communities from the Great Barrier Reef, Australia - Pocillopora damicornis (fresh isolate) - PDam_NLN_DNA_SISPA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Institute of Marine Science
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1793
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Unclassified → Unclassified → Coral Tissue → Coral Viral Communities From The Great Barrier Reef, Australia

Source Dataset Sampling Location
Location Name	Australia: Great Barrier Reef
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001905	Metagenome	619	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117783_1007982	F001905	N/A	MFPFYIRMTILLCVGGFAPILIHHLIMELWDVGILRAAEYTFIVCIPIAVWMAEKINERWNDEDQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.