Scaffold Ga0116649_1001048

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116649_1001048

Scaffold Ga0116649_1001048

Overview

Basic Information
Taxon OID	3300013426 Open in IMG/M
Scaffold ID	Ga0116649_1001048 Open in IMG/M
Source Dataset Name	Baboon gut microbial communities from fecal samples in Kenya - M09
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Duke University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8741
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)	2.717	Long. (^o)	37.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082887	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116649_10010487	F082887	N/A	MEKLKTIAKYLTNILAIVSALVAGINAVDGITIPYAIQIVQVIAVVQGVIGTYLLGQKAIKKEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.