| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013426 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118445 | Gp0134449 | Ga0116649 |
| Sample Name | Baboon gut microbial communities from fecal samples in Kenya - M09 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Duke University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 125838713 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056682 | Metagenome | 137 | Y |
| F082887 | Metagenome / Metatranscriptome | 113 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116649_1001048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 8741 | Open in IMG/M |
| Ga0116649_1004635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2669 | Open in IMG/M |
| Ga0116649_1019195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1007 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116649_1001048 | Ga0116649_10010487 | F082887 | MEKLKTIAKYLTNILAIVSALVAGINAVDGITIPYAIQIVQVIAVVQGVIGTYLLGQKAIKKEE* |
| Ga0116649_1004635 | Ga0116649_10046352 | F056682 | VVEKPHKQNTMKTQSRAGKVANQTIAQGKMYAASFRAFPLKNRITFPFQELGKIHKNQEVL* |
| Ga0116649_1019195 | Ga0116649_10191951 | F056682 | KQNTVKMQSRAGKVANQPIGQGKMYSASFSAFPSKNRITFPIQELRKIHENQEVL* |
| ⦗Top⦘ |