| Basic Information | |
|---|---|
| Taxon OID | 3300013414 Open in IMG/M |
| Scaffold ID | Ga0177923_1143917 Open in IMG/M |
| Source Dataset Name | Rat cecal microbial community from a salt sensitive rat, Toledo, Ohio, USA - rat 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Davis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 696 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Rat Cecum → Rat Cecal Microbial Communities From Salt Sensitive Rats, Toledo, Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toledo, Ohio, USA | |||||||
| Coordinates | Lat. (o) | 41.6639 | Long. (o) | -83.5552 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0177923_11439171 | F077438 | N/A | SLCCVYSTHRVERPFAQRRFETLFLWSLKVEISSDLMPTVEKEISSNKN* |
| ⦗Top⦘ |