Scaffold Ga0173631_1126740

Overview

Basic Information

• Taxon OID: 3300013312
• Scaffold ID: Ga0173631_1126740
• Source Dataset Name: Solar panel surface microbial communities from Valencia, Spain - panel 3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Lifesequencing S.L.
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Solar Panel Surfaces → Solar Panel Surface Microbial Communities From Valencia, Spain

Source Dataset Sampling Location

• Location Name: Valencia, Spain
• Coordinates
  • Lat. (^o): 39.4561165
  • Long. (^o): -0.3545661

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037234	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0173631_11267401	F037234	N/A	MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS*