Scaffold Ga0172517_100544

Overview

Basic Information

• Taxon OID: 3300013290
• Scaffold ID: Ga0172517_100544
• Source Dataset Name: Enriched microbial communities from a natural gas condensate-contaminated anoxic aquifer near Ft. Lupton, CO, USA ? 13C-labelled, 2 mo incubation
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Calgary
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13479
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (45.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Anoxic Aquifer → Stable Isotope And Metagenomic Profiling Of A Methanogenic Naphthalene-Degrading Enrichment Culture

Source Dataset Sampling Location

• Location Name: South Platte Alluvial Aquifer near Denver, CO, USA
• Coordinates
  • Lat. (^o): 40.3921
  • Long. (^o): -104.7158

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091072	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172517_1005448	F091072	N/A	MAGTMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL*