NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136642_1008895

Scaffold Ga0136642_1008895


Overview

Basic Information
Taxon OID3300013285 Open in IMG/M
Scaffold IDGa0136642_1008895 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3194
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From High-Altitude Lakes In Yosemite National Park, California, Usa

Source Dataset Sampling Location
Location NameUSA: Lower Cathedral Lake, Yosemite National Park, California, USA
CoordinatesLat. (o)37.8453Long. (o)-119.4233Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005705Metagenome / Metatranscriptome392Y

Sequences

Protein IDFamilyRBSSequence
Ga0136642_10088959F005705AGGAGMKIVVKIPHKTRAHIVLFCENTPFKPKRVESKKQFKRNPKHKGRDE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.