| Basic Information | |
|---|---|
| Family ID | F005705 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 392 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKVKFKRQPKHKGREQ |
| Number of Associated Samples | 221 |
| Number of Associated Scaffolds | 392 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 76.61 % |
| % of genes near scaffold ends (potentially truncated) | 28.83 % |
| % of genes from short scaffolds (< 2000 bps) | 68.11 % |
| Associated GOLD sequencing projects | 178 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (39.031 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (26.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (78.316 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.05% β-sheet: 0.00% Coil/Unstructured: 95.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 392 Family Scaffolds |
|---|---|---|
| PF06056 | Terminase_5 | 19.64 |
| PF00004 | AAA | 2.30 |
| PF07486 | Hydrolase_2 | 0.77 |
| PF01551 | Peptidase_M23 | 0.26 |
| PF00268 | Ribonuc_red_sm | 0.26 |
| PF03851 | UvdE | 0.26 |
| PF13384 | HTH_23 | 0.26 |
| PF13155 | Toprim_2 | 0.26 |
| PF13385 | Laminin_G_3 | 0.26 |
| PF01370 | Epimerase | 0.26 |
| PF01230 | HIT | 0.26 |
| PF02896 | PEP-utilizers_C | 0.26 |
| PF02543 | Carbam_trans_N | 0.26 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.26 |
| PF00462 | Glutaredoxin | 0.26 |
| COG ID | Name | Functional Category | % Frequency in 392 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.77 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.26 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.26 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.26 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.35 % |
| Unclassified | root | N/A | 32.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02G33PS | Not Available | 521 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c006773 | All Organisms → Viruses → Predicted Viral | 2254 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c009038 | All Organisms → Viruses → Predicted Viral | 1842 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c042437 | Not Available | 597 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c006675 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c018568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1006502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6960 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1037074 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300000439|TBL_comb48_EPIDRAFT_1046564 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10098760 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300000756|JGI12421J11937_10025617 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300000756|JGI12421J11937_10049074 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| 3300000867|EsTDRAFT_1022343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2121 | Open in IMG/M |
| 3300000867|EsTDRAFT_1039268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300002447|JGI24768J34885_10017099 | All Organisms → Viruses → Predicted Viral | 2404 | Open in IMG/M |
| 3300002447|JGI24768J34885_10022616 | All Organisms → Viruses → Predicted Viral | 2088 | Open in IMG/M |
| 3300002835|B570J40625_100236271 | All Organisms → Viruses → Predicted Viral | 1925 | Open in IMG/M |
| 3300002835|B570J40625_100893163 | Not Available | 770 | Open in IMG/M |
| 3300002835|B570J40625_101324169 | Not Available | 597 | Open in IMG/M |
| 3300003277|JGI25908J49247_10002793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5577 | Open in IMG/M |
| 3300003277|JGI25908J49247_10003674 | All Organisms → Viruses → Predicted Viral | 4897 | Open in IMG/M |
| 3300003277|JGI25908J49247_10020393 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300003277|JGI25908J49247_10090889 | Not Available | 743 | Open in IMG/M |
| 3300003375|JGI26470J50227_1003614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4653 | Open in IMG/M |
| 3300003375|JGI26470J50227_1017382 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300003375|JGI26470J50227_1028409 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300003375|JGI26470J50227_1043029 | Not Available | 826 | Open in IMG/M |
| 3300003388|JGI25910J50241_10035127 | All Organisms → Viruses → Predicted Viral | 1665 | Open in IMG/M |
| 3300003388|JGI25910J50241_10047954 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300003393|JGI25909J50240_1112906 | Not Available | 536 | Open in IMG/M |
| 3300003394|JGI25907J50239_1014015 | All Organisms → Viruses → Predicted Viral | 1846 | Open in IMG/M |
| 3300003394|JGI25907J50239_1015022 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
| 3300003395|JGI25917J50250_1091936 | Not Available | 629 | Open in IMG/M |
| 3300003411|JGI25911J50253_10103136 | Not Available | 868 | Open in IMG/M |
| 3300003411|JGI25911J50253_10118398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300003783|Ga0007850_1016074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300003787|Ga0007811_1001386 | All Organisms → Viruses → Predicted Viral | 3491 | Open in IMG/M |
| 3300003787|Ga0007811_1008266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300003787|Ga0007811_1009494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
| 3300003787|Ga0007811_1017320 | Not Available | 636 | Open in IMG/M |
| 3300003796|Ga0007865_1006556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
| 3300003798|Ga0007842_1008836 | Not Available | 681 | Open in IMG/M |
| 3300003804|Ga0007817_1000200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5121 | Open in IMG/M |
| 3300003804|Ga0007817_1000476 | All Organisms → Viruses → Predicted Viral | 3344 | Open in IMG/M |
| 3300003806|Ga0007864_1004305 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
| 3300003815|Ga0007856_1008030 | Not Available | 730 | Open in IMG/M |
| 3300003823|Ga0007875_1018627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300004112|Ga0065166_10258052 | Not Available | 702 | Open in IMG/M |
| 3300004112|Ga0065166_10462735 | Not Available | 535 | Open in IMG/M |
| 3300004112|Ga0065166_10484480 | Not Available | 523 | Open in IMG/M |
| 3300004128|Ga0066180_10145590 | Not Available | 897 | Open in IMG/M |
| 3300004481|Ga0069718_13599442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
| 3300004481|Ga0069718_16165494 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
| 3300004684|Ga0065168_1039880 | Not Available | 739 | Open in IMG/M |
| 3300004686|Ga0065173_1053713 | Not Available | 729 | Open in IMG/M |
| 3300004687|Ga0065174_1044746 | Not Available | 838 | Open in IMG/M |
| 3300004692|Ga0065171_1006209 | All Organisms → Viruses → Predicted Viral | 1892 | Open in IMG/M |
| 3300004692|Ga0065171_1028093 | Not Available | 905 | Open in IMG/M |
| 3300004763|Ga0007746_1006925 | All Organisms → Viruses → Predicted Viral | 2897 | Open in IMG/M |
| 3300004765|Ga0007745_1028558 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300004770|Ga0007804_1033889 | All Organisms → Viruses → Predicted Viral | 1373 | Open in IMG/M |
| 3300004772|Ga0007791_10146936 | Not Available | 691 | Open in IMG/M |
| 3300004774|Ga0007794_10143844 | Not Available | 712 | Open in IMG/M |
| 3300004777|Ga0007827_10113912 | Not Available | 606 | Open in IMG/M |
| 3300004792|Ga0007761_11081769 | Not Available | 530 | Open in IMG/M |
| 3300004807|Ga0007809_10048051 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300005517|Ga0070374_10221823 | Not Available | 970 | Open in IMG/M |
| 3300005527|Ga0068876_10056199 | All Organisms → Viruses → Predicted Viral | 2392 | Open in IMG/M |
| 3300005580|Ga0049083_10216318 | Not Available | 649 | Open in IMG/M |
| 3300005582|Ga0049080_10021865 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300005582|Ga0049080_10158562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300005584|Ga0049082_10006322 | All Organisms → Viruses → Predicted Viral | 3953 | Open in IMG/M |
| 3300005584|Ga0049082_10051887 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
| 3300005584|Ga0049082_10060759 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300005662|Ga0078894_10139385 | All Organisms → Viruses → Predicted Viral | 2170 | Open in IMG/M |
| 3300005662|Ga0078894_10162529 | All Organisms → Viruses → Predicted Viral | 2011 | Open in IMG/M |
| 3300005662|Ga0078894_10201592 | All Organisms → Viruses → Predicted Viral | 1801 | Open in IMG/M |
| 3300005662|Ga0078894_10255388 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
| 3300005662|Ga0078894_10343811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1351 | Open in IMG/M |
| 3300005662|Ga0078894_11020439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300005662|Ga0078894_11174203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300005662|Ga0078894_11204445 | Not Available | 641 | Open in IMG/M |
| 3300005662|Ga0078894_11655361 | Not Available | 526 | Open in IMG/M |
| 3300006071|Ga0007876_1000813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11326 | Open in IMG/M |
| 3300006071|Ga0007876_1142784 | Not Available | 601 | Open in IMG/M |
| 3300006100|Ga0007806_1053008 | Not Available | 776 | Open in IMG/M |
| 3300006100|Ga0007806_1090976 | Not Available | 564 | Open in IMG/M |
| 3300006100|Ga0007806_1102159 | Not Available | 527 | Open in IMG/M |
| 3300006100|Ga0007806_1104986 | Not Available | 518 | Open in IMG/M |
| 3300006114|Ga0007815_1064533 | Not Available | 745 | Open in IMG/M |
| 3300006115|Ga0007816_1072866 | Not Available | 764 | Open in IMG/M |
| 3300006117|Ga0007818_1019277 | All Organisms → Viruses → Predicted Viral | 1364 | Open in IMG/M |
| 3300006117|Ga0007818_1078608 | Not Available | 608 | Open in IMG/M |
| 3300006118|Ga0007859_1059531 | Not Available | 786 | Open in IMG/M |
| 3300006127|Ga0007805_1067088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300006128|Ga0007828_1000286 | Not Available | 13600 | Open in IMG/M |
| 3300006484|Ga0070744_10081078 | Not Available | 940 | Open in IMG/M |
| 3300006641|Ga0075471_10007395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6928 | Open in IMG/M |
| 3300006805|Ga0075464_10295081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
| 3300006805|Ga0075464_10541785 | Not Available | 714 | Open in IMG/M |
| 3300006805|Ga0075464_10639649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300007169|Ga0102976_1140878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Robiginitomaculaceae → Robiginitomaculum → unclassified Robiginitomaculum → Robiginitomaculum sp. | 3534 | Open in IMG/M |
| 3300007546|Ga0102874_1026847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1879 | Open in IMG/M |
| 3300007547|Ga0102875_1257205 | Not Available | 533 | Open in IMG/M |
| 3300007549|Ga0102879_1092510 | Not Available | 944 | Open in IMG/M |
| 3300007559|Ga0102828_1043747 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
| 3300007560|Ga0102913_1161642 | Not Available | 722 | Open in IMG/M |
| 3300007562|Ga0102915_1221083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300007634|Ga0102901_1054729 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300007647|Ga0102855_1084105 | Not Available | 855 | Open in IMG/M |
| 3300008052|Ga0102893_1156243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300008108|Ga0114341_10079315 | All Organisms → Viruses → Predicted Viral | 2571 | Open in IMG/M |
| 3300008122|Ga0114359_1351021 | Not Available | 504 | Open in IMG/M |
| 3300008964|Ga0102889_1106210 | Not Available | 832 | Open in IMG/M |
| 3300008996|Ga0102831_1024768 | All Organisms → Viruses → Predicted Viral | 2044 | Open in IMG/M |
| 3300008996|Ga0102831_1037206 | All Organisms → Viruses → Predicted Viral | 1643 | Open in IMG/M |
| 3300008999|Ga0102816_1044505 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
| 3300008999|Ga0102816_1113549 | Not Available | 830 | Open in IMG/M |
| 3300009026|Ga0102829_1187278 | Not Available | 670 | Open in IMG/M |
| 3300009050|Ga0102909_1155369 | Not Available | 549 | Open in IMG/M |
| 3300009068|Ga0114973_10016202 | All Organisms → Viruses → Predicted Viral | 4695 | Open in IMG/M |
| 3300009068|Ga0114973_10131779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1400 | Open in IMG/M |
| 3300009151|Ga0114962_10116042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1648 | Open in IMG/M |
| 3300009151|Ga0114962_10121073 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
| 3300009151|Ga0114962_10137246 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300009151|Ga0114962_10190839 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300009151|Ga0114962_10216914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
| 3300009151|Ga0114962_10481042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300009151|Ga0114962_10713274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009151|Ga0114962_10736413 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 502 | Open in IMG/M |
| 3300009152|Ga0114980_10741267 | Not Available | 549 | Open in IMG/M |
| 3300009154|Ga0114963_10240418 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300009155|Ga0114968_10000305 | Not Available | 36536 | Open in IMG/M |
| 3300009159|Ga0114978_10018179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5234 | Open in IMG/M |
| 3300009159|Ga0114978_10252024 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300009159|Ga0114978_10418242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300009159|Ga0114978_10809457 | Not Available | 528 | Open in IMG/M |
| 3300009164|Ga0114975_10012752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5210 | Open in IMG/M |
| 3300009164|Ga0114975_10018300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4264 | Open in IMG/M |
| 3300009164|Ga0114975_10025482 | All Organisms → Viruses → Predicted Viral | 3561 | Open in IMG/M |
| 3300009164|Ga0114975_10050807 | All Organisms → Viruses → Predicted Viral | 2444 | Open in IMG/M |
| 3300009164|Ga0114975_10053590 | All Organisms → Viruses → Predicted Viral | 2372 | Open in IMG/M |
| 3300009164|Ga0114975_10054281 | All Organisms → Viruses → Predicted Viral | 2357 | Open in IMG/M |
| 3300009164|Ga0114975_10094060 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
| 3300009164|Ga0114975_10127738 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300009164|Ga0114975_10137579 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300009164|Ga0114975_10237751 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300009164|Ga0114975_10423297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300009164|Ga0114975_10456077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300009164|Ga0114975_10726430 | Not Available | 524 | Open in IMG/M |
| 3300009182|Ga0114959_10008622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7211 | Open in IMG/M |
| 3300009182|Ga0114959_10023625 | All Organisms → Viruses → Predicted Viral | 3851 | Open in IMG/M |
| 3300009182|Ga0114959_10086712 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300009182|Ga0114959_10175275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300009182|Ga0114959_10293645 | Not Available | 813 | Open in IMG/M |
| 3300009182|Ga0114959_10296841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300009182|Ga0114959_10420161 | Not Available | 652 | Open in IMG/M |
| 3300009182|Ga0114959_10637664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 507 | Open in IMG/M |
| 3300009183|Ga0114974_10800421 | Not Available | 506 | Open in IMG/M |
| 3300009184|Ga0114976_10480020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300009185|Ga0114971_10517609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300009502|Ga0114951_10008479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8419 | Open in IMG/M |
| 3300009502|Ga0114951_10390426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300009684|Ga0114958_10212413 | Not Available | 964 | Open in IMG/M |
| 3300009684|Ga0114958_10529852 | Not Available | 565 | Open in IMG/M |
| 3300009684|Ga0114958_10584213 | Not Available | 534 | Open in IMG/M |
| 3300010157|Ga0114964_10080797 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300010157|Ga0114964_10293617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300010157|Ga0114964_10474860 | Not Available | 589 | Open in IMG/M |
| 3300010158|Ga0114960_10315789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300010158|Ga0114960_10469112 | Not Available | 607 | Open in IMG/M |
| 3300010158|Ga0114960_10482301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 597 | Open in IMG/M |
| 3300010158|Ga0114960_10634489 | Not Available | 503 | Open in IMG/M |
| 3300010160|Ga0114967_10178506 | All Organisms → Viruses | 1158 | Open in IMG/M |
| 3300010160|Ga0114967_10288143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 848 | Open in IMG/M |
| 3300010334|Ga0136644_10197899 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300010334|Ga0136644_10258781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
| 3300010388|Ga0136551_1002518 | All Organisms → Viruses → Predicted Viral | 4457 | Open in IMG/M |
| 3300010885|Ga0133913_12728625 | Not Available | 1193 | Open in IMG/M |
| 3300010885|Ga0133913_13375169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300011010|Ga0139557_1026281 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300011268|Ga0151620_1030596 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300012000|Ga0119951_1003053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8864 | Open in IMG/M |
| 3300012663|Ga0157203_1003355 | All Organisms → Viruses → Predicted Viral | 3344 | Open in IMG/M |
| 3300012663|Ga0157203_1006597 | All Organisms → Viruses → Predicted Viral | 2122 | Open in IMG/M |
| 3300012663|Ga0157203_1007530 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300012663|Ga0157203_1019529 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300012665|Ga0157210_1000590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14355 | Open in IMG/M |
| 3300012665|Ga0157210_1002574 | All Organisms → Viruses → Predicted Viral | 4603 | Open in IMG/M |
| 3300012665|Ga0157210_1003108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3945 | Open in IMG/M |
| 3300012665|Ga0157210_1010728 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300012665|Ga0157210_1022040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300012750|Ga0157568_1113106 | Not Available | 722 | Open in IMG/M |
| 3300012773|Ga0138290_1045251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300012774|Ga0138283_1157595 | Not Available | 528 | Open in IMG/M |
| 3300012779|Ga0138284_1244150 | Not Available | 714 | Open in IMG/M |
| 3300012780|Ga0138271_1077672 | Not Available | 614 | Open in IMG/M |
| 3300013006|Ga0164294_11102301 | Not Available | 532 | Open in IMG/M |
| 3300013093|Ga0164296_1007529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8926 | Open in IMG/M |
| 3300013093|Ga0164296_1063065 | Not Available | 1696 | Open in IMG/M |
| 3300013093|Ga0164296_1116562 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300013093|Ga0164296_1222766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300013094|Ga0164297_10122557 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300013094|Ga0164297_10390952 | Not Available | 532 | Open in IMG/M |
| 3300013285|Ga0136642_1007960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3418 | Open in IMG/M |
| 3300013285|Ga0136642_1008895 | All Organisms → Viruses → Predicted Viral | 3194 | Open in IMG/M |
| 3300013285|Ga0136642_1020268 | Not Available | 1949 | Open in IMG/M |
| 3300013285|Ga0136642_1184784 | Not Available | 509 | Open in IMG/M |
| 3300013286|Ga0136641_1004979 | All Organisms → Viruses → Predicted Viral | 4900 | Open in IMG/M |
| 3300013286|Ga0136641_1023841 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
| 3300013286|Ga0136641_1065968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
| 3300013295|Ga0170791_11769582 | All Organisms → Viruses → Predicted Viral | 2726 | Open in IMG/M |
| 3300013295|Ga0170791_14650654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300017761|Ga0181356_1186933 | Not Available | 621 | Open in IMG/M |
| 3300017778|Ga0181349_1077608 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300019093|Ga0187843_10026021 | All Organisms → Viruses → Predicted Viral | 2982 | Open in IMG/M |
| 3300019784|Ga0181359_1031920 | All Organisms → Viruses → Predicted Viral | 2037 | Open in IMG/M |
| 3300020141|Ga0211732_1090699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300020141|Ga0211732_1256288 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
| 3300020141|Ga0211732_1283892 | All Organisms → Viruses → Predicted Viral | 2685 | Open in IMG/M |
| 3300020141|Ga0211732_1321233 | Not Available | 599 | Open in IMG/M |
| 3300020141|Ga0211732_1343205 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300020141|Ga0211732_1448034 | Not Available | 1155 | Open in IMG/M |
| 3300020160|Ga0211733_10919215 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300020160|Ga0211733_11169536 | Not Available | 625 | Open in IMG/M |
| 3300020160|Ga0211733_11184091 | Not Available | 790 | Open in IMG/M |
| 3300020161|Ga0211726_10110265 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300020162|Ga0211735_11146144 | All Organisms → Viruses → Predicted Viral | 2833 | Open in IMG/M |
| 3300020205|Ga0211731_10416327 | Not Available | 530 | Open in IMG/M |
| 3300020205|Ga0211731_11485705 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
| 3300020686|Ga0214194_103272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli | 1619 | Open in IMG/M |
| 3300020705|Ga0214177_1000728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7721 | Open in IMG/M |
| 3300020716|Ga0214207_1033898 | Not Available | 579 | Open in IMG/M |
| 3300020716|Ga0214207_1040803 | Not Available | 515 | Open in IMG/M |
| 3300020718|Ga0214178_1001289 | Not Available | 6019 | Open in IMG/M |
| 3300020727|Ga0214246_1003114 | All Organisms → Viruses → Predicted Viral | 3669 | Open in IMG/M |
| 3300020731|Ga0214170_1000440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15038 | Open in IMG/M |
| 3300020731|Ga0214170_1002604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4554 | Open in IMG/M |
| 3300020731|Ga0214170_1003765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3620 | Open in IMG/M |
| 3300020731|Ga0214170_1006872 | All Organisms → Viruses → Predicted Viral | 2452 | Open in IMG/M |
| 3300020731|Ga0214170_1021233 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300020733|Ga0214172_1005423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2864 | Open in IMG/M |
| 3300020733|Ga0214172_1014491 | All Organisms → Viruses → Predicted Viral | 1392 | Open in IMG/M |
| 3300020733|Ga0214172_1042720 | Not Available | 654 | Open in IMG/M |
| 3300021123|Ga0214212_1016367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300021125|Ga0214211_1002051 | All Organisms → Viruses → Predicted Viral | 2611 | Open in IMG/M |
| 3300021126|Ga0214187_1028094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300021131|Ga0214206_1003490 | All Organisms → Viruses → Predicted Viral | 2980 | Open in IMG/M |
| 3300021133|Ga0214175_1014843 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300021134|Ga0214171_1048178 | Not Available | 550 | Open in IMG/M |
| 3300021138|Ga0214164_1084817 | Not Available | 619 | Open in IMG/M |
| 3300021139|Ga0214166_1007333 | All Organisms → Viruses → Predicted Viral | 3363 | Open in IMG/M |
| 3300021141|Ga0214163_1009772 | All Organisms → Viruses → Predicted Viral | 3228 | Open in IMG/M |
| 3300021438|Ga0213920_1003307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6899 | Open in IMG/M |
| 3300021516|Ga0194045_1165019 | Not Available | 549 | Open in IMG/M |
| 3300021519|Ga0194048_10008903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4637 | Open in IMG/M |
| 3300021519|Ga0194048_10086382 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300021519|Ga0194048_10090243 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
| 3300021519|Ga0194048_10116440 | Not Available | 1021 | Open in IMG/M |
| 3300021519|Ga0194048_10158069 | Not Available | 850 | Open in IMG/M |
| 3300021952|Ga0213921_1058610 | Not Available | 553 | Open in IMG/M |
| 3300021956|Ga0213922_1035448 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300022407|Ga0181351_1215150 | Not Available | 629 | Open in IMG/M |
| 3300022555|Ga0212088_10019241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9366 | Open in IMG/M |
| 3300022591|Ga0236341_1001833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11433 | Open in IMG/M |
| 3300022602|Ga0248169_138617 | All Organisms → Viruses → Predicted Viral | 2355 | Open in IMG/M |
| 3300023174|Ga0214921_10063834 | All Organisms → Viruses → Predicted Viral | 3080 | Open in IMG/M |
| 3300023174|Ga0214921_10397220 | Not Available | 706 | Open in IMG/M |
| 3300023184|Ga0214919_10364638 | Not Available | 956 | Open in IMG/M |
| 3300024343|Ga0244777_10026553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3672 | Open in IMG/M |
| 3300024346|Ga0244775_10169273 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
| 3300024346|Ga0244775_10338717 | Not Available | 1243 | Open in IMG/M |
| 3300024346|Ga0244775_10464712 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| 3300024346|Ga0244775_11247217 | Not Available | 577 | Open in IMG/M |
| 3300024348|Ga0244776_10044075 | All Organisms → Viruses → Predicted Viral | 3518 | Open in IMG/M |
| 3300024348|Ga0244776_10494143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300025091|Ga0209616_1002946 | All Organisms → Viruses → Predicted Viral | 2621 | Open in IMG/M |
| 3300025336|Ga0208619_101167 | Not Available | 1809 | Open in IMG/M |
| 3300025336|Ga0208619_104398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300025357|Ga0208383_1014106 | Not Available | 982 | Open in IMG/M |
| 3300025369|Ga0208382_1027650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300025372|Ga0207957_1004692 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
| 3300025379|Ga0208738_1000352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12894 | Open in IMG/M |
| 3300025379|Ga0208738_1010853 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300025379|Ga0208738_1018082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
| 3300025381|Ga0208871_1006090 | All Organisms → Viruses → Predicted Viral | 2227 | Open in IMG/M |
| 3300025381|Ga0208871_1027348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300025383|Ga0208250_1003884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3262 | Open in IMG/M |
| 3300025392|Ga0208380_1002406 | All Organisms → Viruses → Predicted Viral | 4053 | Open in IMG/M |
| 3300025396|Ga0208874_1005623 | All Organisms → Viruses → Predicted Viral | 2551 | Open in IMG/M |
| 3300025400|Ga0208387_1003774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3420 | Open in IMG/M |
| 3300025407|Ga0208378_1040451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300025410|Ga0208875_1041338 | Not Available | 737 | Open in IMG/M |
| 3300025413|Ga0208614_1000717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9295 | Open in IMG/M |
| 3300025413|Ga0208614_1032216 | Not Available | 816 | Open in IMG/M |
| 3300025417|Ga0208616_1000478 | Not Available | 10848 | Open in IMG/M |
| 3300025426|Ga0208739_1005335 | All Organisms → Viruses → Predicted Viral | 2694 | Open in IMG/M |
| 3300025466|Ga0208497_1081647 | Not Available | 607 | Open in IMG/M |
| 3300025578|Ga0208864_1092481 | Not Available | 720 | Open in IMG/M |
| 3300025648|Ga0208507_1198193 | Not Available | 524 | Open in IMG/M |
| 3300025723|Ga0208741_10028239 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300025773|Ga0208104_1045866 | Not Available | 502 | Open in IMG/M |
| 3300025782|Ga0208867_1031894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300027125|Ga0255106_1001236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5135 | Open in IMG/M |
| 3300027304|Ga0208810_1110514 | Not Available | 545 | Open in IMG/M |
| 3300027320|Ga0208923_1002148 | All Organisms → Viruses → Predicted Viral | 3662 | Open in IMG/M |
| 3300027418|Ga0208022_1017363 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300027563|Ga0209552_1000362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14558 | Open in IMG/M |
| 3300027581|Ga0209651_1029615 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
| 3300027586|Ga0208966_1016591 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
| 3300027642|Ga0209135_1053886 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300027707|Ga0209443_1006153 | Not Available | 6255 | Open in IMG/M |
| 3300027707|Ga0209443_1009432 | All Organisms → Viruses → Predicted Viral | 4806 | Open in IMG/M |
| 3300027707|Ga0209443_1045190 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
| 3300027707|Ga0209443_1114525 | Not Available | 1010 | Open in IMG/M |
| 3300027708|Ga0209188_1009146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5758 | Open in IMG/M |
| 3300027708|Ga0209188_1017152 | Not Available | 3822 | Open in IMG/M |
| 3300027708|Ga0209188_1019261 | All Organisms → Viruses → Predicted Viral | 3540 | Open in IMG/M |
| 3300027708|Ga0209188_1039489 | All Organisms → Viruses → Predicted Viral | 2178 | Open in IMG/M |
| 3300027708|Ga0209188_1042141 | All Organisms → Viruses → Predicted Viral | 2083 | Open in IMG/M |
| 3300027708|Ga0209188_1089915 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300027734|Ga0209087_1223938 | Not Available | 708 | Open in IMG/M |
| 3300027741|Ga0209085_1003360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8794 | Open in IMG/M |
| 3300027741|Ga0209085_1007414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5625 | Open in IMG/M |
| 3300027741|Ga0209085_1142484 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300027746|Ga0209597_1000171 | Not Available | 42419 | Open in IMG/M |
| 3300027747|Ga0209189_1015506 | All Organisms → Viruses → Predicted Viral | 4227 | Open in IMG/M |
| 3300027747|Ga0209189_1104460 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300027747|Ga0209189_1137054 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300027749|Ga0209084_1026693 | All Organisms → Viruses → Predicted Viral | 3024 | Open in IMG/M |
| 3300027749|Ga0209084_1062339 | Not Available | 1748 | Open in IMG/M |
| 3300027749|Ga0209084_1203336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300027759|Ga0209296_1000553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32594 | Open in IMG/M |
| 3300027759|Ga0209296_1008494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6293 | Open in IMG/M |
| 3300027759|Ga0209296_1075370 | All Organisms → Viruses → Predicted Viral | 1677 | Open in IMG/M |
| 3300027759|Ga0209296_1086865 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300027759|Ga0209296_1163833 | Not Available | 986 | Open in IMG/M |
| 3300027759|Ga0209296_1168425 | Not Available | 967 | Open in IMG/M |
| 3300027763|Ga0209088_10022548 | All Organisms → Viruses → Predicted Viral | 3239 | Open in IMG/M |
| 3300027763|Ga0209088_10042756 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300027763|Ga0209088_10071199 | All Organisms → Viruses | 1644 | Open in IMG/M |
| 3300027769|Ga0209770_10197788 | Not Available | 795 | Open in IMG/M |
| 3300027772|Ga0209768_10285264 | Not Available | 700 | Open in IMG/M |
| 3300027782|Ga0209500_10013835 | All Organisms → Viruses → Predicted Viral | 4880 | Open in IMG/M |
| 3300027782|Ga0209500_10174401 | Not Available | 991 | Open in IMG/M |
| 3300027782|Ga0209500_10275950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300027785|Ga0209246_10044096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1712 | Open in IMG/M |
| 3300027797|Ga0209107_10008675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5705 | Open in IMG/M |
| 3300027797|Ga0209107_10238230 | Not Available | 880 | Open in IMG/M |
| 3300027798|Ga0209353_10058286 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300027798|Ga0209353_10336147 | Not Available | 633 | Open in IMG/M |
| 3300027836|Ga0209230_10090316 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
| 3300027896|Ga0209777_10348674 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300027963|Ga0209400_1000224 | Not Available | 50661 | Open in IMG/M |
| 3300027969|Ga0209191_1009205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5308 | Open in IMG/M |
| 3300027969|Ga0209191_1043791 | All Organisms → Viruses → Predicted Viral | 2077 | Open in IMG/M |
| 3300027969|Ga0209191_1059886 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300027969|Ga0209191_1076376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300027969|Ga0209191_1162344 | Not Available | 904 | Open in IMG/M |
| 3300027969|Ga0209191_1241521 | Not Available | 692 | Open in IMG/M |
| 3300027971|Ga0209401_1061938 | All Organisms → Viruses → Predicted Viral | 1652 | Open in IMG/M |
| 3300028392|Ga0304729_1024788 | All Organisms → Viruses → Predicted Viral | 2499 | Open in IMG/M |
| 3300028392|Ga0304729_1108329 | Not Available | 937 | Open in IMG/M |
| 3300028393|Ga0304728_1120037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300028393|Ga0304728_1125724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300028394|Ga0304730_1009016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5984 | Open in IMG/M |
| 3300031759|Ga0316219_1007536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6913 | Open in IMG/M |
| 3300031759|Ga0316219_1153342 | Not Available | 851 | Open in IMG/M |
| 3300031759|Ga0316219_1332938 | Not Available | 514 | Open in IMG/M |
| 3300031787|Ga0315900_10028691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6240 | Open in IMG/M |
| 3300031884|Ga0316220_1054820 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300031963|Ga0315901_10351305 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300032117|Ga0316218_1078340 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300032561|Ga0316222_1314240 | Not Available | 510 | Open in IMG/M |
| 3300032675|Ga0316225_1015808 | All Organisms → Viruses → Predicted Viral | 3665 | Open in IMG/M |
| 3300032753|Ga0316224_1084513 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300033816|Ga0334980_0014629 | All Organisms → Viruses → Predicted Viral | 3385 | Open in IMG/M |
| 3300033992|Ga0334992_0019383 | All Organisms → Viruses → Predicted Viral | 4244 | Open in IMG/M |
| 3300033994|Ga0334996_0007644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7273 | Open in IMG/M |
| 3300034013|Ga0334991_0007586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7369 | Open in IMG/M |
| 3300034063|Ga0335000_0249969 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300034082|Ga0335020_0002788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11811 | Open in IMG/M |
| 3300034082|Ga0335020_0057111 | All Organisms → Viruses → Predicted Viral | 2041 | Open in IMG/M |
| 3300034082|Ga0335020_0184737 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300034093|Ga0335012_0386593 | Not Available | 687 | Open in IMG/M |
| 3300034102|Ga0335029_0087364 | All Organisms → Viruses → Predicted Viral | 2220 | Open in IMG/M |
| 3300034107|Ga0335037_0422100 | Not Available | 718 | Open in IMG/M |
| 3300034117|Ga0335033_0042811 | All Organisms → Viruses → Predicted Viral | 2808 | Open in IMG/M |
| 3300034121|Ga0335058_0193328 | All Organisms → Viruses → Predicted Viral | 1189 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.28% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 16.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.38% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.55% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.79% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.53% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.28% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.02% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.02% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.77% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.51% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine | 0.51% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.26% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.26% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.26% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000867 | Estuary microbial communities from the Columbia River - metatranscriptome 5 PSU | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
| 3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
| 3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
| 3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012750 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES069 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020705 | Freshwater microbial communities from Trout Bog Lake, WI - 27AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
| 3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021123 | Freshwater microbial communities from Trout Bog Lake, WI - 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021126 | Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021134 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027304 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_3712530 | 2035265000 | Freshwater | MNTKQVTPKKHREHYVLFCKDTPFKQKVVDSKIKYRRQPKH |
| TB03JUN2009E_0067733 | 3300000176 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKIKYKRNPKHKGRDE* |
| TB03JUN2009E_0090384 | 3300000176 | Freshwater | MKIVIKIPKKHREHFVLFAXNTPFKQKVVESKLLYKRNKKHKGRDNDRDYT* |
| TB03JUN2009E_0253973 | 3300000176 | Freshwater | KTRAHFVLFAENTPFKPKVVKSKKQFKRNPKHKGRDE* |
| TB03JUN2009E_0424371 | 3300000176 | Freshwater | VKIIIKVPKKHREHFVLFTQNTPFKPKKVESKIKYKR |
| TB18AUG2009E_0066755 | 3300000203 | Freshwater | VKIIIKVPRKTRAHFVLFAENTPFKPKVVKSKKEYTRKQKHKGRDV* |
| TB18AUG2009E_0185681 | 3300000203 | Freshwater | VKIIIKVPKKHREHFVLFTQNTPFKPKKVESKIKYKRNPKHKGARDE* |
| TBL_comb48_EPIDRAFT_100650218 | 3300000439 | Freshwater | MKIVVKVPQKTRAHLVLFCANTPFKQKRVESKIKYKRQPKHKGREQ* |
| TBL_comb48_EPIDRAFT_10370743 | 3300000439 | Freshwater | MKIVIKVPQKTRAHFVLFAEXTPFKPXRVESKVLYKRNKKHKGRDYE* |
| TBL_comb48_EPIDRAFT_10465644 | 3300000439 | Freshwater | MKIVIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRQPKHKGREL* |
| TBL_comb47_HYPODRAFT_100987601 | 3300000553 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNK |
| JGI12421J11937_100256177 | 3300000756 | Freshwater And Sediment | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGREQ* |
| JGI12421J11937_100490742 | 3300000756 | Freshwater And Sediment | VKIIIKVPKQVRAHIVLFCKDTPFKQKVVQSKKQFKRQPKHKGREQ* |
| EsTDRAFT_10223432 | 3300000867 | Freshwater And Marine | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGTHND* |
| EsTDRAFT_10392682 | 3300000867 | Freshwater And Marine | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKIKYKRQPKHKGQQND* |
| JGI24768J34885_100170993 | 3300002447 | Freshwater And Sediment | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVQSKKQFKRNPKHKGRDQ* |
| JGI24768J34885_100226164 | 3300002447 | Freshwater And Sediment | VKITIKVSKKHREHFVLFAQNTPFKQKVVASKVKFKRNPKHKGREQ* |
| B570J40625_1002362714 | 3300002835 | Freshwater | MKIVIKIPKQIRAHIVLFCKDTPFKQKVVQSKKQFKRNPKHKGREQ* |
| B570J40625_1008931631 | 3300002835 | Freshwater | VKITIKVSKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHRNKEQ* |
| B570J40625_1013241692 | 3300002835 | Freshwater | MKITIKVKPKHRKHIVLFCAGTPFKQKVVESKIKYKRNPKHKGQHND* |
| JGI25908J49247_1000279312 | 3300003277 | Freshwater Lake | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHKGKHND* |
| JGI25908J49247_100036744 | 3300003277 | Freshwater Lake | VKITIKVSKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGREQ* |
| JGI25908J49247_100203932 | 3300003277 | Freshwater Lake | MKITIKVKPKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND* |
| JGI25908J49247_100908891 | 3300003277 | Freshwater Lake | PKKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND* |
| JGI26470J50227_100361410 | 3300003375 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDNDRDYT* |
| JGI26470J50227_10173824 | 3300003375 | Freshwater | MKIVVKIPQKTRAHFVLFCENTPFKPKRVESKIKYKRQAKHKGKRDE* |
| JGI26470J50227_10284094 | 3300003375 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE* |
| JGI26470J50227_10430291 | 3300003375 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKH |
| JGI25910J50241_100351276 | 3300003388 | Freshwater Lake | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRDN |
| JGI25910J50241_100479542 | 3300003388 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND* |
| JGI25909J50240_11129062 | 3300003393 | Freshwater Lake | VKIVIKLPKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHKGKHND* |
| JGI25907J50239_10140156 | 3300003394 | Freshwater Lake | VKIVIKISKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGREQ* |
| JGI25907J50239_10150225 | 3300003394 | Freshwater Lake | VKIVIKVPKQIRAHIVLFCKDTPFKQKVVASKIKFKRNPKHKGRDNG* |
| JGI25917J50250_10919363 | 3300003395 | Freshwater Lake | PKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND* |
| JGI25911J50253_101031361 | 3300003411 | Freshwater Lake | VKIVIKVPKQIRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGRDNG* |
| JGI25911J50253_101183981 | 3300003411 | Freshwater Lake | VKITIKIQKKHREHFVLFAQNTPFKQKVVASKIKYQRNPKHKGREQ* |
| Ga0007850_10160741 | 3300003783 | Freshwater | MNKIVVKIPQKTRAHRVLFLSDTPFKPQRVERKDRYKRRSKHPGRDHNG* |
| Ga0007811_10013863 | 3300003787 | Freshwater | MKIVIKVPKQVRAHIVLFCKDTPFKPKRVENKLAYKRKPKHKGRDYE* |
| Ga0007811_10082662 | 3300003787 | Freshwater | VKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYE*LGS* |
| Ga0007811_10094942 | 3300003787 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKPKVVESKLAYKRKPKHKGRDYE* |
| Ga0007811_10173202 | 3300003787 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKRVESKIKYKRNPKHKGARDE* |
| Ga0007865_10065563 | 3300003796 | Freshwater | VKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYE* |
| Ga0007842_10088362 | 3300003798 | Freshwater | MKIVVKIPHKTRAHFVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0007817_10002008 | 3300003804 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKIKYKRNPKHRGRDE* |
| Ga0007817_10004762 | 3300003804 | Freshwater | MKIVIKVPQKTRAHFVLFAEXTPFKPKRVESKVLYKRNKKHKGRDYE* |
| Ga0007864_10043053 | 3300003806 | Freshwater | MKIVIKLPKRHREHFVLFAQHTPFKPKRVESKLLYKRNTKHKGRDYE* |
| Ga0007856_10080302 | 3300003815 | Freshwater | MKIVVKVPHKTRAHFVLFKEGTPFKQKVVESKIKYKRQPKHKGREL* |
| Ga0007875_10186271 | 3300003823 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKXHKGRDYE* |
| Ga0065166_102580522 | 3300004112 | Freshwater Lake | VKITIKIPKKHREHFVLFAQNTPFKQKVVASKVKFKRNPKHKGRDE* |
| Ga0065166_104627351 | 3300004112 | Freshwater Lake | MKITIKVKPKHREHIVLFCAGTPFKQKVVESKVKYKRQPKHKGQHND* |
| Ga0065166_104844801 | 3300004112 | Freshwater Lake | MKITIKIPKKHREHFVLFAQNTPFKQKVVASKVKYNRKPKHKGRTDD* |
| Ga0066180_101455901 | 3300004128 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQ |
| Ga0069718_135994425 | 3300004481 | Sediment | VKIVIKVPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRKPKHKGRDE* |
| Ga0069718_161654946 | 3300004481 | Sediment | DRQEHQVKITIKVSKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHRNKEQ* |
| Ga0065168_10398801 | 3300004684 | Freshwater | MKIVIKVPHKTRAHFVLFAENTPFKPKVVKSKKQFKRNPKHKGRDE* |
| Ga0065173_10537132 | 3300004686 | Freshwater | MDKIVVKIPQKTRAHKVLFLSNSPFKAKKVELKTRYKRQPKHKKSADFG* |
| Ga0065174_10447464 | 3300004687 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKPKVVESKLAYKRKPKHKGRDY |
| Ga0065171_10062092 | 3300004692 | Freshwater | MKIVIKVKPKHREHFVLFAQNTPFKPKKVERKDLYKRNPKHKGREL* |
| Ga0065171_10280932 | 3300004692 | Freshwater | MKIVIKIPKKHREHFVLYAQNTPFKQKVVESKIKYKRQPKHKGRDND* |
| Ga0007746_10069252 | 3300004763 | Freshwater Lake | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRDNG* |
| Ga0007745_10285583 | 3300004765 | Freshwater Lake | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRNNG* |
| Ga0007804_10338893 | 3300004770 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL* |
| Ga0007791_101469363 | 3300004772 | Freshwater | MKIVVKIPQKTRAHFVLFCADTPFKQKRVENKKQYKRNPKHKGRDE* |
| Ga0007794_101438442 | 3300004774 | Freshwater | MKIVVKVPTQVRAHIVLFCKDTPFKQKVVQSKIKYKRQPKHKGKHND* |
| Ga0007827_101139122 | 3300004777 | Freshwater | MKIVVKIPQKTRAHFVLFCENTPFKPKRVENKKAFKRNPKHKGRDE* |
| Ga0007761_110817692 | 3300004792 | Freshwater Lake | MKIIIKVKPKHREHIILFCAGTPFKQKVVESKVKYKRQPKHKGQHND* |
| Ga0007809_100480514 | 3300004807 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGARDE* |
| Ga0070374_102218233 | 3300005517 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKVKFKRQPKHKGQQND* |
| Ga0068876_100561991 | 3300005527 | Freshwater Lake | VKITVKIPKQVRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGARHAD* |
| Ga0049083_102163182 | 3300005580 | Freshwater Lentic | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKIQYRRQPKHKGQHND* |
| Ga0049080_100218655 | 3300005582 | Freshwater Lentic | MKIVIKVPKQTRAHIVLFCKDTPFKQKVVASKVKFKRQPKHKGARNAD* |
| Ga0049080_101585621 | 3300005582 | Freshwater Lentic | TIKIQKKHREHFVLFAQNTPFKQKVVASKIKYQRNPKHKGREQ* |
| Ga0049082_100063223 | 3300005584 | Freshwater Lentic | MKIVVKMPQKTRAHLVLFCANTPFKQKRVESKIAYKRQPKHKGRDNG* |
| Ga0049082_100518875 | 3300005584 | Freshwater Lentic | VKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGREQ* |
| Ga0049082_100607594 | 3300005584 | Freshwater Lentic | VKITIKIPKKHREHFVLFAQNTPFKQKVVASKIKYQRNPKHKGREQ* |
| Ga0078894_101393854 | 3300005662 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKIQYKRQPKHKGREQ* |
| Ga0078894_101625295 | 3300005662 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKKQFKRQPKHKGREQ* |
| Ga0078894_102015924 | 3300005662 | Freshwater Lake | VKITIKVPKKHREHLVLFCAGTPFKQKVVESKIKYKRNPKHKGARHGE* |
| Ga0078894_102553883 | 3300005662 | Freshwater Lake | VKITVKIPKQIRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGREQ* |
| Ga0078894_103438113 | 3300005662 | Freshwater Lake | VKITIKIPKKHREHFVLFAQNTPFKQKVVDSKIKYKRQPKHRNKEQ* |
| Ga0078894_110204391 | 3300005662 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKVKFKRQPKHRGKHND* |
| Ga0078894_111742033 | 3300005662 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHRGKQND* |
| Ga0078894_112044451 | 3300005662 | Freshwater Lake | MKITIKIPKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHKGQQND* |
| Ga0078894_116553612 | 3300005662 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKMQYKRNPKHKGREQ* |
| Ga0007876_10008131 | 3300006071 | Freshwater | MMDKIVVKIPQKTRAHKVLFLSNSPFKAKKVELKTRYKRQPKHKKSADFG* |
| Ga0007876_11427843 | 3300006071 | Freshwater | MKIVIKVPRKTRAHFVLFSENTPFKPKVVKSKKAFKRNPKHKGRDE* |
| Ga0007806_10530082 | 3300006100 | Freshwater | MKIVVKIPQKTRAHFVLFCKDTPFKQKVVKSKKAFKRNPKHKGRDE* |
| Ga0007806_10909761 | 3300006100 | Freshwater | KIVIKIPKKHREHFVLFAQNTPFKPKRVESKLLYKRNTKHKGQSYE* |
| Ga0007806_11021592 | 3300006100 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYE* |
| Ga0007806_11049863 | 3300006100 | Freshwater | KESDVKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL* |
| Ga0007815_10645331 | 3300006114 | Freshwater | HSKESDVKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL* |
| Ga0007816_10728662 | 3300006115 | Freshwater | MKIVIKVPHKTRAHFVLFAENTPFKPKVVKSKKAFKRNPKHKGRDE* |
| Ga0007818_10192775 | 3300006117 | Freshwater | DVKIIIKVPKKHREHFVLFAQNTPFKPKRVESKIKYKRNPKHKGARDE* |
| Ga0007818_10786084 | 3300006117 | Freshwater | RAHLVLFQTNTPFRPKRVELKTVYQRKPKHKGKDYE* |
| Ga0007859_10595314 | 3300006118 | Freshwater | MKIVIKVKPKHREHFVLFAQNTPFKPKKVERKDLY |
| Ga0007805_10670881 | 3300006127 | Freshwater | IKIPKKHREHFVLFAQNTPFKPKRVESKLLYKRNTKHKGQSYE* |
| Ga0007828_10002865 | 3300006128 | Freshwater | MKIKLTVPVRTRAHFVLFAQNTPFRPKRVESKKQYSRKPKHPNKLHD* |
| Ga0007834_11178963 | 3300006129 | Freshwater | KTRAHFVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0070744_100810781 | 3300006484 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKH |
| Ga0075471_1000739520 | 3300006641 | Aqueous | MKLKKHREHFVLFCANTPFKQKVVKSKKAFKRNPKHKGRDNG* |
| Ga0075464_102950814 | 3300006805 | Aqueous | VKIVIKVPRKHREHIILFCEGTPFKQKVVESKIKYKRQPKHKGKHD* |
| Ga0075464_105417852 | 3300006805 | Aqueous | VKITVKIPKQVRAHIVLFCKDTPFKQKVVQSKIKFKRNPKHKGRDE* |
| Ga0075464_106396493 | 3300006805 | Aqueous | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKIKFKRQPKHKGKHND* |
| Ga0102976_114087811 | 3300007169 | Freshwater Lake | MKITIVLPKGKHRAHLALFVKDTPFKPKVVENKKAFKRHKKHKGKDAE* |
| Ga0102874_10268475 | 3300007546 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKQND* |
| Ga0102875_12572051 | 3300007547 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFRQKVVQSKVKYTRQPKHRGKQND* |
| Ga0102879_10925103 | 3300007549 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGTHND* |
| Ga0102828_10437471 | 3300007559 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGKHND* |
| Ga0102913_11616423 | 3300007560 | Estuarine | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPK |
| Ga0102915_12210831 | 3300007562 | Estuarine | NAMKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGKHND* |
| Ga0102901_10547294 | 3300007634 | Estuarine | MKIVVKIPHKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKGRDN |
| Ga0102855_10841054 | 3300007647 | Estuarine | VKITIRIPKKHREHIVLFCAGTPFKQKVVQSKVKFKR |
| Ga0102893_11562433 | 3300008052 | Estuarine | SKESEMKIVIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHRGKQND* |
| Ga0114341_100793158 | 3300008108 | Freshwater, Plankton | SKESDVKITVKIPKQVRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGARHAD* |
| Ga0114359_13510213 | 3300008122 | Freshwater, Plankton | KVPKKHREHIILFCAGTPFKQKVVNSKVKFKRQPKHKGQQND* |
| Ga0102889_11062104 | 3300008964 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHRGKQND* |
| Ga0102831_10247681 | 3300008996 | Estuarine | KIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKQND* |
| Ga0102831_10372065 | 3300008996 | Estuarine | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYKRQPKHKGKHND* |
| Ga0102816_10445054 | 3300008999 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKLND* |
| Ga0102816_11135493 | 3300008999 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFRQKVVQSKVKYTRQPKHRGKHND* |
| Ga0102829_11872783 | 3300009026 | Estuarine | MKIVVKIPHKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKGRDNG* |
| Ga0102909_11553691 | 3300009050 | Estuarine | VPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHRGKQND* |
| Ga0114973_100162026 | 3300009068 | Freshwater Lake | MAYSKESDVKITIKIPKKHREHFVLFAQNTPFKQKVVESKVKYKRNPKHKGREQ* |
| Ga0114973_101317794 | 3300009068 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCANTPFKQKVVASKIKFKRQPKHKGRDNG* |
| Ga0114962_101160425 | 3300009151 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYKRQPKHKGKYD* |
| Ga0114962_101210736 | 3300009151 | Freshwater Lake | MKIIIKVPKKHREHIVLFCAGTPFKPKVVQSKVKFKRQPKHRGREQ* |
| Ga0114962_101372464 | 3300009151 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ* |
| Ga0114962_101908392 | 3300009151 | Freshwater Lake | MKITIKVPKQVRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGREQ* |
| Ga0114962_102169143 | 3300009151 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVASKIKYKRQPKHKGRDNG* |
| Ga0114962_104810421 | 3300009151 | Freshwater Lake | KITIKIPKKHREHFVLFAQNTPFRQKVVESKVKYKRNPKHKGREQ* |
| Ga0114962_107132742 | 3300009151 | Freshwater Lake | MTSSKESDVKITIKIPKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHKGREQ* |
| Ga0114962_107364131 | 3300009151 | Freshwater Lake | YRQEHTVKIVIKVSKKHREHFVLFAQNTPFKQKVVESKIKYKRNPKHKGRDNG* |
| Ga0114980_107412671 | 3300009152 | Freshwater Lake | KKHREHYVLFCAGTPFKQKRVELKTRYNRQPKHKGQHND* |
| Ga0114963_102404182 | 3300009154 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVESKVKYKRNPKHKGARNED* |
| Ga0114968_100003057 | 3300009155 | Freshwater Lake | MKIVVKIPQKTRRHYVLFANDSPFRPQRVEPKTRYRRRPKHINKQEYSA* |
| Ga0114978_100181793 | 3300009159 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKYKRQPKHKGREL* |
| Ga0114978_102520242 | 3300009159 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKVKFKRQPKHKGREQ* |
| Ga0114978_104182421 | 3300009159 | Freshwater Lake | KIVIKVPKKHREHIILFCAGTPFKQKVVKSKIQYKRQPKHKGKQND* |
| Ga0114978_108094571 | 3300009159 | Freshwater Lake | NTYRQEHTVKITIKIQKKHREHFVLFAQNTPFKQKVVASKVKFKRNPKHKGREQ* |
| Ga0114975_100127527 | 3300009164 | Freshwater Lake | MPYNTHMKIAIKIPQKTRAHLVLFCKDTPFKPKVVQSKKTYNRKPKHKGKQDD* |
| Ga0114975_100183009 | 3300009164 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0114975_1002548210 | 3300009164 | Freshwater Lake | VKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGKQND* |
| Ga0114975_100508074 | 3300009164 | Freshwater Lake | MKIVIKIKPKHREHYILFAQNTPFKQKVVDSKVKYKRQPKHKGQHND* |
| Ga0114975_100535906 | 3300009164 | Freshwater Lake | MKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKIKYKRQPKHKGKHND* |
| Ga0114975_100542815 | 3300009164 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVKSKIQYKRQPKHKGKQND* |
| Ga0114975_100940606 | 3300009164 | Freshwater Lake | MKIVVKLPQKTRAHLVLFCANTPFKQKVVASKVKFKRNPKHKGREQ* |
| Ga0114975_101277382 | 3300009164 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKYKRQPKHRGREA* |
| Ga0114975_101375794 | 3300009164 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCAGTPFKQKRVESKMQYKRNPKHKGTRNAD* |
| Ga0114975_102377512 | 3300009164 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCANTPFKQKVVASKIKFKRQPKHKGRDNG* |
| Ga0114975_104232972 | 3300009164 | Freshwater Lake | MKITIKVPKQVRAHIVLFCKDTPFKQKVVQSKKQFKRQPKHKGREQ* |
| Ga0114975_104560773 | 3300009164 | Freshwater Lake | EHTVKITIKIQKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGREQ* |
| Ga0114975_107264302 | 3300009164 | Freshwater Lake | MKIVVKVPHKTRAHLVLFCKDTPFKQKRVECKTTYRRKPKHKGRDYE* |
| Ga0114959_100086223 | 3300009182 | Freshwater Lake | MKITVKIPKKTRAHFVLFCKDTPFKPKQVENKKAFKRNPKHKGKDNG* |
| Ga0114959_100236252 | 3300009182 | Freshwater Lake | VKIVIKVPKKHREHIVLFCAGTPFKQKVVASKVKFKRNPKHKGARNAD* |
| Ga0114959_100867123 | 3300009182 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQYKRNPKHKGTHNAD* |
| Ga0114959_101752755 | 3300009182 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ* |
| Ga0114959_102936454 | 3300009182 | Freshwater Lake | KESEMKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKVKYTRQPKHRGKQND* |
| Ga0114959_102968411 | 3300009182 | Freshwater Lake | TIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKHND* |
| Ga0114959_104201611 | 3300009182 | Freshwater Lake | MKIVIKVPKKHREHFVLFAQNTPFKPKRVENKKAFKRNPKHKGREQ* |
| Ga0114959_106376641 | 3300009182 | Freshwater Lake | EHTMKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0114974_108004211 | 3300009183 | Freshwater Lake | MKIVVKMPQKTRAHLVLFCANTPFKQKVVASKVKFKRNPKHKG |
| Ga0114976_104800203 | 3300009184 | Freshwater Lake | KKHREHYVLFCTGTPFKQKRVELKTRYTRQPKHKGQHND* |
| Ga0114971_105176091 | 3300009185 | Freshwater Lake | RQEHTVKIIIKVSKKHREHFVLFAQNTPFKQKVVESKIKYKRNPKHKGREL* |
| Ga0114951_100084795 | 3300009502 | Freshwater | MKIIIKVKPKHREHFVLFAQNTPFKQKVVESKVLYRRNKKHKGRDYE* |
| Ga0114951_103904262 | 3300009502 | Freshwater | MKLVIKVPKQVRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGREQ* |
| Ga0114958_102124131 | 3300009684 | Freshwater Lake | VKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKH |
| Ga0114958_105298523 | 3300009684 | Freshwater Lake | CSLFWTYNRVNKESDVKIVIKVPKKHREHIVLFCAGTPFKQKVVASKVKFKRNPKHKGARHAD* |
| Ga0114958_105842131 | 3300009684 | Freshwater Lake | NTYRQEHTVKITIKIPKKHREHFVLFAQNTPFKQKVVESKIKYKRNPKHKGREL* |
| Ga0114964_100807975 | 3300010157 | Freshwater Lake | MKIVVKIPQKTRAHFVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0114964_102936171 | 3300010157 | Freshwater Lake | PKQIRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGREQ* |
| Ga0114964_104748603 | 3300010157 | Freshwater Lake | MKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKVKYTRQPKHRGKQND*YRTARTDCTSAH |
| Ga0114960_103157891 | 3300010158 | Freshwater Lake | QEHTMKITIKVPKQVRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ* |
| Ga0114960_104691122 | 3300010158 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVENKKAFKRNPKHKGRDE* |
| Ga0114960_104823013 | 3300010158 | Freshwater Lake | IKVPKQVRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGREQ* |
| Ga0114960_106344891 | 3300010158 | Freshwater Lake | VKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTR |
| Ga0114967_101785061 | 3300010160 | Freshwater Lake | VKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKH |
| Ga0114967_102881432 | 3300010160 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVESKIKYKRQPKHKGREQ* |
| Ga0136644_101978991 | 3300010334 | Freshwater Lake | MKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKVKYTRQPKHRGKQND* |
| Ga0136644_102587813 | 3300010334 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQFKRNPKHKGREQ* |
| Ga0136551_10025186 | 3300010388 | Pond Fresh Water | MKITVKIPHKTRAHLVLFCKDTPFKAKVVENKKAYRRKSKHKGRNDDHN* |
| Ga0133913_127286254 | 3300010885 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKGRDNG* |
| Ga0133913_133751693 | 3300010885 | Freshwater Lake | MNTTKATPKKTRAHFVLFCAGTPFKQKRVENKKAYNRQPKHKGREQ* |
| Ga0139557_10262811 | 3300011010 | Freshwater | TMKITIKVPKKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND* |
| Ga0151620_10305964 | 3300011268 | Freshwater | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKMQYKRNPKHKGTRNAD* |
| Ga0119951_100305319 | 3300012000 | Freshwater | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQYKRNPKHKGNHNAD* |
| Ga0157203_10033552 | 3300012663 | Freshwater | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKVKFKRQPKHKGKHND* |
| Ga0157203_10065975 | 3300012663 | Freshwater | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVANKVKFKRNPKHKGDRNAD* |
| Ga0157203_10075303 | 3300012663 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKVKYKRQPKHKGQHND* |
| Ga0157203_10195294 | 3300012663 | Freshwater | MAYSKESDVKITVKIPKQVRAHIVLFCKDTPFKQKVVASKVKFKRN |
| Ga0157210_100059018 | 3300012665 | Freshwater | LQHSKESDVKITIKIPKKHREHIILFCENTPFKPKVVESKKKFKRQPKHKGREL* |
| Ga0157210_10025742 | 3300012665 | Freshwater | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKIKFKRQPKHKGKEL* |
| Ga0157210_10031085 | 3300012665 | Freshwater | MAYSKESDVKITVKIPKQVRAHIVLFCKDTPFKQKVVESKVKYKRKPKHKGRDE* |
| Ga0157210_10107283 | 3300012665 | Freshwater | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGREQ* |
| Ga0157210_10220402 | 3300012665 | Freshwater | MAYSKESDVKITIKIPKKHREHFVLFAQNTPFRQKVVESKIKYKRNPKHKGREQ* |
| Ga0157568_11131062 | 3300012750 | Freshwater | MKIVIKVKPKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL* |
| Ga0138290_10452511 | 3300012773 | Freshwater Lake | DVKITIKIPKKHREHFVLFAQNTPFKQKVVESKIKYRRNPKHKGREQ* |
| Ga0138283_11575953 | 3300012774 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKYKRQPK |
| Ga0138284_12441501 | 3300012779 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCAGTPFKQKVVESKVKFKRNPKHKGREQ* |
| Ga0138271_10776722 | 3300012780 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKQND* |
| Ga0164294_111023012 | 3300013006 | Freshwater | MKITIKVPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGREQ* |
| Ga0164296_10075296 | 3300013093 | Freshwater | MNKIVVKIPQKTRAHRVLFLSHTPFKPKRVERKDLYQRKPKHPGRDSNG* |
| Ga0164296_10630654 | 3300013093 | Freshwater | MKITIKIPKKHREHFILFAQNTPFKQKVVESKIKYKRQPKHKGREL* |
| Ga0164296_11165623 | 3300013093 | Freshwater | MKIVIKVPRKTRAHFVLFSENTPFKPKVVKSKVLYKRNKKHKGRDYE* |
| Ga0164296_12227661 | 3300013093 | Freshwater | MKIVVKVPHKTRTHFVLFCKDTPFKQKVVESKVKYKRKDKHRSRHDYN* |
| Ga0164297_101225571 | 3300013094 | Freshwater | MKIVIKVPRKTRAHFVLFAENTPFKPKVVKSKKEYTRKQKHKGRD |
| Ga0164297_103909523 | 3300013094 | Freshwater | MKIVVKIPQKTRAHFVLFCENTPFKPKRVESKIKYKRQAKH |
| Ga0136642_10079603 | 3300013285 | Freshwater | MKITIKVPKQVRAHIVLFCKDTPFKQKVVESKVKYKRQPKHKGKHND* |
| Ga0136642_10088959 | 3300013285 | Freshwater | MKIVVKIPHKTRAHIVLFCENTPFKPKRVESKKQFKRNPKHKGRDE* |
| Ga0136642_10202683 | 3300013285 | Freshwater | VKIIIKIPKKHREHFVLFAQNTPFRQKVVASKIKFKRNPKHKGRDE* |
| Ga0136642_11847843 | 3300013285 | Freshwater | MKIVVKIPHKTRAHFVLFCADTPFKQKRVESKKKFKRNPKHRGREL* |
| Ga0136641_10049799 | 3300013286 | Freshwater | MKIVIKVPKKHRQHIVLFCAGTPFRQKVVQSKVKFKRQPKHRGREQ* |
| Ga0136641_10238416 | 3300013286 | Freshwater | MKITIKVPKQVRAHIVLFCKDTPFKQKRVESKVKYKRQPKHRGREQ* |
| Ga0136641_10659682 | 3300013286 | Freshwater | MKIVVKIPHKTRAHIVLFCANTPFKQKRVESKIVYKRKPKHKGKSDE* |
| Ga0170791_117695821 | 3300013295 | Freshwater | YNTFLVDSRPKMPYNTHMKIAIKIPQKTRAHLVLFCKDTPFKPKVVQSKKTYNRKPKHKGKQDD* |
| Ga0170791_146506541 | 3300013295 | Freshwater | KKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGKQND* |
| Ga0181356_11869331 | 3300017761 | Freshwater Lake | IVIKVPKQIRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGRDNG |
| Ga0181349_10776081 | 3300017778 | Freshwater Lake | QEHQVKITIKVSKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGREQ |
| Ga0187843_100260212 | 3300019093 | Freshwater | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGREQ |
| Ga0181359_10319205 | 3300019784 | Freshwater Lake | VKIVIKVPKQIRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGRDNG |
| Ga0211732_10906992 | 3300020141 | Freshwater | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKIKFKRQPKHKGKHND |
| Ga0211732_12562884 | 3300020141 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYKRQPKHKGKEL |
| Ga0211732_12838923 | 3300020141 | Freshwater | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRDNG |
| Ga0211732_13212332 | 3300020141 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKVKYKRQPKHKGQHND |
| Ga0211732_13432053 | 3300020141 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKVKFKRQPKHKGQHND |
| Ga0211732_14480343 | 3300020141 | Freshwater | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKIKYKRNPKHKGREQ |
| Ga0211733_109192153 | 3300020160 | Freshwater | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKIQYKRQPKHKGQQND |
| Ga0211733_111695363 | 3300020160 | Freshwater | MKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRDNE |
| Ga0211733_111840912 | 3300020160 | Freshwater | MKIVVKIPKQVRAHIVLFCKDTPFKQKRVESKVKFKRNPKHKGARHGE |
| Ga0211726_101102655 | 3300020161 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYKRQPKHKGKLND |
| Ga0211735_111461448 | 3300020162 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKILYKRQPKHKGKEL |
| Ga0211731_104163271 | 3300020205 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKVKYKRQPKHKGQQND |
| Ga0211731_114857053 | 3300020205 | Freshwater | RQEHKMKITIKLPKQVRAHIVLFCKDTPFKQKVVQSKVKFKRNPKHKGRDNG |
| Ga0214194_1032724 | 3300020686 | Freshwater | MKIVVKVPQKTRAHLVLFCANTPFKQKRVESKIKYKRQPKHKGREQ |
| Ga0214177_100072819 | 3300020705 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDNDRDYT |
| Ga0214207_10338981 | 3300020716 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKG |
| Ga0214207_10408032 | 3300020716 | Freshwater | MKIVVKIPQKTRAHFVLFCENTPFKPKRVESKIKYKRQAKHKGKRDE |
| Ga0214178_10012894 | 3300020718 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0214246_100311411 | 3300020727 | Freshwater | MKIVIKVPHKTRAHFVLFAENTPFKPKVVKSKKQFKRNPKHKGRDE |
| Ga0214170_100044015 | 3300020731 | Freshwater | MNKIVVKIPQKTRAHRVLFLSHTPFKPKRVERKDLYQRKPKHPGRDSNG |
| Ga0214170_100260412 | 3300020731 | Freshwater | MKITIKIPKKHREHFILFAQNTPFKQKVVESKIKYKRQPKHKGREL |
| Ga0214170_10037653 | 3300020731 | Freshwater | MNKIVVKIPQKTRAHRVLFLSDTPFKPQRVERKDRYKRRSKHPGRDHNG |
| Ga0214170_10068728 | 3300020731 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKIKYKRNPKHRGRDE |
| Ga0214170_10212331 | 3300020731 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKG |
| Ga0214172_10054233 | 3300020733 | Freshwater | MMDKIVVKIPQKTRAHKVLFLSNSPFKAKKVELKTRYKRQPKHKKSADFG |
| Ga0214172_10144912 | 3300020733 | Freshwater | MKIVIKVPRKTRAHFVLFAENTPFKSKVVKSKKEYTRKQKHKGRDE |
| Ga0214172_10427202 | 3300020733 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKIKYKRNPKHKGRDE |
| Ga0214212_10163673 | 3300021123 | Freshwater | SKESDVKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGARDE |
| Ga0214211_10020517 | 3300021125 | Freshwater | VKIIIKVPKKHREHFVLFTQNTPFKPKKVESKIKYKRNPKHKGARDE |
| Ga0214187_10280941 | 3300021126 | Freshwater | KVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0214206_10034909 | 3300021131 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHKGREL |
| Ga0214175_10148435 | 3300021133 | Freshwater | MKIVIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRQPKHKGR |
| Ga0214171_10481782 | 3300021134 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDNDRDYTXRIESTPT |
| Ga0214164_10848171 | 3300021138 | Freshwater | VKIIIKVPKKHREHFVLFTQNTPFKPKKVESKIKYKRNPKH |
| Ga0214166_100733312 | 3300021139 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKPKRVESKLAYKRNPKHKGRDV |
| Ga0214163_10097729 | 3300021141 | Freshwater | VKITIKVSKKHREHFVLFAQNTPFKQKVVESKIKYKRQPKHRNKEQ |
| Ga0213920_10033074 | 3300021438 | Freshwater | MNTTKATPKKTRAHFVLFCAGTPFKQKRVENKQAYKRQPKHKGREQ |
| Ga0194045_11650191 | 3300021516 | Anoxic Zone Freshwater | VNKESDVKIVIKVPKKHREHIVLFCAGTPFKQKVVASKVKFKRNPKHKGARNAD |
| Ga0194048_1000890314 | 3300021519 | Anoxic Zone Freshwater | IKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGKHND |
| Ga0194048_100863821 | 3300021519 | Anoxic Zone Freshwater | MKIVIKVPKKHREHIILFCAGTPFKQKVVASKVKYTRQPKHKGKHND |
| Ga0194048_100902434 | 3300021519 | Anoxic Zone Freshwater | PKQTRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGERNAD |
| Ga0194048_101164403 | 3300021519 | Anoxic Zone Freshwater | MKITVKIPKKTRAHFVLFCKDTPFKPKQVENKKAFKRNPKHKGKDNG |
| Ga0194048_101580691 | 3300021519 | Anoxic Zone Freshwater | VKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKG |
| Ga0213921_10586103 | 3300021952 | Freshwater | MKITIKIPKKHREHFILFAQNTPFKQKVVESKVKYRRQPKHKGQQHD |
| Ga0213922_10354483 | 3300021956 | Freshwater | MKIVVKVPQKTRAHLVLFCKDTPFKQKRVESKIKYKRQPKHKGRDE |
| Ga0181351_12151502 | 3300022407 | Freshwater Lake | VKIVIKISKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGREQ |
| Ga0212088_1001924118 | 3300022555 | Freshwater Lake Hypolimnion | MKIIIKVKPKHREHFVLFAQNTPFKQKVVESKVLYRRNKKHKGRDYE |
| Ga0236341_100183319 | 3300022591 | Freshwater | MKIVVKIPHKTRAHLVLFCADTPFKQKVVESKIKYKRQAKHKGKRDE |
| Ga0248169_1386176 | 3300022602 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGARDE |
| Ga0214921_100638344 | 3300023174 | Freshwater | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQYKRNPKHKGNHNAD |
| Ga0214921_103972203 | 3300023174 | Freshwater | MKIVIKVPKKHREHIILFCAGTPFRQKVVQSKVKYTRQPKHRGKQND |
| Ga0214919_103646382 | 3300023184 | Freshwater | VKIVIKVPKKHREHIILFCAGTPFKQKVVESKVKYKRQPKHKGKHND |
| Ga0244777_100265534 | 3300024343 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHRGKQND |
| Ga0244775_101692736 | 3300024346 | Estuarine | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYKRQPKHKGKHND |
| Ga0244775_103387173 | 3300024346 | Estuarine | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGTHND |
| Ga0244775_104647123 | 3300024346 | Estuarine | MKIVVKIPHKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKGRDNG |
| Ga0244775_112472173 | 3300024346 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFRQKVVQSKVKYTRQPKHRGKHND |
| Ga0244776_100440751 | 3300024348 | Estuarine | KKHREHIILFCAGTPFRQKVVQSKVKYTRQPKHRGKQND |
| Ga0244776_104941434 | 3300024348 | Estuarine | VKIPHKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKGRDNG |
| Ga0255152_10104232 | 3300024503 | Freshwater | MKLKKHREHLVLFCANTPFKPKVVKSKKAFKRNPKHKGRDNGXDYIERIER |
| Ga0209616_10029464 | 3300025091 | Freshwater | VKITIKIAKKHREHFVLFAQNTPFKQKVVASKVKFKRNPKHKGRDE |
| Ga0208619_1011673 | 3300025336 | Freshwater | MKIVVKIPQKTRAHFVLFCENTPFKPKRVENKKAFKRNPKHKGRDE |
| Ga0208619_1043984 | 3300025336 | Freshwater | MKIVVKVPHKTRAHFVLFKEGTPFKQKVVESKIKYKRQPKHKGREL |
| Ga0208383_10141064 | 3300025357 | Freshwater | MKIVVKIPHKTRAHFVLFCANTPFKQKRVESKKQFKRNPKHKGREQ |
| Ga0208382_10276501 | 3300025369 | Freshwater | MKIVIKVKPKHREHFVLFAQNTPFKPKVVESKVLYKRNKKHKGRDYE |
| Ga0207957_10046925 | 3300025372 | Freshwater | MKIVIKVKPKHREHFVLFAQNTPFKPKKVERKDLYKRNPKHKGREL |
| Ga0208738_100035220 | 3300025379 | Freshwater | MKIVIKVPKQVRAHIVLFCKDTPFKPKRVENKLAYKRKPKHKGRDYE |
| Ga0208738_10108531 | 3300025379 | Freshwater | MKIVIKLPKRHREHFVLFAQHTPFKPKRVESKLLYKRNTKHKGRDYE |
| Ga0208738_10180822 | 3300025379 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKPKVVESKLAYKRKPKHKGRDYE |
| Ga0208871_10060906 | 3300025381 | Freshwater | MKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGARDE |
| Ga0208871_10273481 | 3300025381 | Freshwater | VPKKHREHFVLFAQNTPFKPKRVESKIKYKRNPKHKGARDE |
| Ga0208250_100388410 | 3300025383 | Freshwater | IVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0208380_10024063 | 3300025392 | Freshwater | MKIVVKIPHKTRAHFVLFAENTPFKPKVVKSKKTFKRNPKHKGRDE |
| Ga0208874_10056233 | 3300025396 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKRVESKIKYKRNPKHKGARDE |
| Ga0208387_10037743 | 3300025400 | Freshwater | VKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYE |
| Ga0208378_10404511 | 3300025407 | Freshwater | PQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0208875_10413381 | 3300025410 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKPKVVESKLAY |
| Ga0208614_100071722 | 3300025413 | Freshwater | SEMKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0208614_10322161 | 3300025413 | Freshwater | ESDVKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL |
| Ga0208616_100047810 | 3300025417 | Freshwater | MKIKLTVPVRTRAHFVLFAQNTPFRPKRVESKKQYSRKPKHPNKLHD |
| Ga0208739_10053352 | 3300025426 | Freshwater | VKIIIKVPKKRREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGARDE |
| Ga0208497_10816473 | 3300025466 | Freshwater | VKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLY |
| Ga0208864_10924812 | 3300025578 | Freshwater | MKIVVKIPQKTRAHFVLFCADTPFKQKRVENKKQYKRNPKHKGRDE |
| Ga0208507_11981931 | 3300025648 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKK |
| Ga0208741_100282395 | 3300025723 | Freshwater | VKIIIKVPKKHRAHFVLFAQNTPFKPKRVESKIKYKRNPKHKGARDE |
| Ga0208104_10458663 | 3300025773 | Freshwater | VPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGRDYE |
| Ga0208867_10318944 | 3300025782 | Freshwater | IPQKTRAHFVLFCENTPFKPKRVESKIKYKRQAKHKGKRDE |
| Ga0255106_100123615 | 3300027125 | Freshwater | MKITIKVPKKHREHIVLFCAGTPFKQKVVNSKVKFKRQPKHKGQHND |
| Ga0208810_11105141 | 3300027304 | Estuarine | KKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHRGKQND |
| Ga0208923_100214812 | 3300027320 | Estuarine | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHR |
| Ga0208022_10173636 | 3300027418 | Estuarine | AMKITIKVPKKHREHIILFCAGTPFKQKVVQSKIQYKRQPKHRGKHND |
| Ga0209552_100036215 | 3300027563 | Freshwater Lake | MKITIKVKPKHREHIILFCAGTPFKQKVVESKVKFKRQPKHKGQHND |
| Ga0209651_10296151 | 3300027581 | Freshwater Lake | MKIIIKVKPKHREHIILFCAGTPFKQKVVESKVKYKRQPKHKGQHND |
| Ga0208966_10165915 | 3300027586 | Freshwater Lentic | MKIVVKMPQKTRAHLVLFCANTPFKQKRVESKIAYKRQPKHKGRDNG |
| Ga0209135_10538863 | 3300027642 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVESKVKFK |
| Ga0209443_10061531 | 3300027707 | Freshwater Lake | VKIVIKISKKHREHFVLFAQNTPFKQKVVASKIKY |
| Ga0209443_10094321 | 3300027707 | Freshwater Lake | KHSKERAMKITIKVKPKHREHIILFCAGTPFKQKVVESKVKYKRQPKHKGQHND |
| Ga0209443_10451902 | 3300027707 | Freshwater Lake | MKIVIKVPKKHREHIILFCAGTPFKQKVVQSKIQYRRQPKHKGKHND |
| Ga0209443_11145251 | 3300027707 | Freshwater Lake | MKITIKVKPKHREHIILFCAGTPFKQKVVESKVKFKRQPK |
| Ga0209188_10091465 | 3300027708 | Freshwater Lake | MKIIIKVPKKHREHIVLFCAGTPFKPKVVQSKVKFKRQPKHRGREQ |
| Ga0209188_10171522 | 3300027708 | Freshwater Lake | VKIVIKVPKKHREHIVLFCAGTPFKQKVVASKVKFKRNPKHKGARNAD |
| Ga0209188_10192614 | 3300027708 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQFKRNPKHKGREQ |
| Ga0209188_10394893 | 3300027708 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVASKIKYKRQPKHKGRDNG |
| Ga0209188_10421414 | 3300027708 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQYKRNPKHKGTHNAD |
| Ga0209188_10899153 | 3300027708 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ |
| Ga0209087_12239383 | 3300027734 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKYKRQPKHKGREL |
| Ga0209085_100336022 | 3300027741 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYKRQPKHKGKYD |
| Ga0209085_100741416 | 3300027741 | Freshwater Lake | MKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKVKYTRQPKHRGKQND |
| Ga0209085_11424844 | 3300027741 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVESKVKYKRNPKHKGARNED |
| Ga0209597_100017125 | 3300027746 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCANTPFKQKVVASKIKFKRQPKHKGRDNG |
| Ga0209189_101550616 | 3300027747 | Freshwater Lake | KITIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHRGKQND |
| Ga0209189_11044603 | 3300027747 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVENKKAFKRNPKHKGRDE |
| Ga0209189_11370544 | 3300027747 | Freshwater Lake | IPKKTRAHFVLFCKDTPFKPKQVENKKAFKRNPKHKGKDNG |
| Ga0209084_10266937 | 3300027749 | Freshwater Lake | VKITIKIQKKHREHFVLFAQNTPFKQKVVASKIKYKRNPKHKGRDNG |
| Ga0209084_10623396 | 3300027749 | Freshwater Lake | VKITIKIPKKHREHFVLFAQNTPFKQKVVESKIKYKRNPKHKGREL |
| Ga0209084_12033361 | 3300027749 | Freshwater Lake | YRQEHTMKIVIKVPKQVRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ |
| Ga0209296_100055348 | 3300027759 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKETPFKQKRVESKVKYKRQPKHKGREL |
| Ga0209296_100849410 | 3300027759 | Freshwater Lake | MPYNTHMKIAIKIPQKTRAHLVLFCKDTPFKPKVVQSKKTYNRKPKHKGKQDD |
| Ga0209296_10753705 | 3300027759 | Freshwater Lake | MKIVIKVPKQIRAHIVLFCKDTPFKQKRVESKVKYKRQPKHRGREA |
| Ga0209296_10868651 | 3300027759 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCANTPFKQKRVESKKQFKRNPKHKGREQ |
| Ga0209296_11638332 | 3300027759 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVKSKIQYKRQPKHKGKQND |
| Ga0209296_11684254 | 3300027759 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCANTPFKQKVVASKIKFKRQPKHKGRDNG |
| Ga0209088_1002254810 | 3300027763 | Freshwater Lake | MKITIKVPKKHREHIVLFCAGTPFKQKVVQSKVKFKRQPKHKGREQ |
| Ga0209088_100427564 | 3300027763 | Freshwater Lake | MKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKIKYKRQPKHKGKHND |
| Ga0209088_100711995 | 3300027763 | Freshwater Lake | MKIVIKIKPKHREHYILFAQNTPFKQKVVDSKVKYKRQPKHKGQHND |
| Ga0209770_101977883 | 3300027769 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCANTPFKQKRVESKMQYKRNPKHKGREQ |
| Ga0209768_102852641 | 3300027772 | Freshwater Lake | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKIQYRRQPKHKGQ |
| Ga0209500_100138353 | 3300027782 | Freshwater Lake | MKITIRVPKQVRAHIVLFCKDTPFKQKVVESKVKYKRNPKHKGREQ |
| Ga0209500_101744011 | 3300027782 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCANTPFKQKRVESKKQF |
| Ga0209500_102759503 | 3300027782 | Freshwater Lake | TIKVPKKHREHIILFCAGTPFKQKVVKSKIQYKRQPKHKGKQND |
| Ga0209246_100440961 | 3300027785 | Freshwater Lake | VKIVIKVPRKHREHIILFCEGTPFKQKVVESKIKYKRQPKH |
| Ga0209107_100086757 | 3300027797 | Freshwater And Sediment | VKITIKIPKKHREHFVLFAQNTPFKQKVVASKIKYQRNPKHKGREQ |
| Ga0209107_102382301 | 3300027797 | Freshwater And Sediment | MKITIKVPKKHREHIILFCAGTPFKQKVVQSKVKFKRQPKHKGREQ |
| Ga0209353_100582867 | 3300027798 | Freshwater Lake | KHREHIILFCAGTPFKQKVVNSKVKFKRQPKHKGQQND |
| Ga0209353_103361472 | 3300027798 | Freshwater Lake | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVANKVKFKRNPKHKGARNAD |
| Ga0209230_100903164 | 3300027836 | Freshwater And Sediment | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVQSKKQFKRNPKHKGRDQ |
| Ga0209777_103486743 | 3300027896 | Freshwater Lake Sediment | MKIVIKIPKKHREHFVLFAQNTPFKPKRVESKLAYKRKSKHKGRDYE |
| Ga0209400_100022472 | 3300027963 | Freshwater Lake | MKIVVKIPQKTRRHYVLFANDSPFRPQRVEPKTRYRRRPKHINKQEYSA |
| Ga0209191_100920515 | 3300027969 | Freshwater Lake | VKIVIKVPKKHREHIILFCAGTPFKQKVVQSKVKYTRQPKHKGKQND |
| Ga0209191_10437911 | 3300027969 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCAGTPFKQKRVESKMQYKRNPKHK |
| Ga0209191_10598866 | 3300027969 | Freshwater Lake | MKIVVKLPQKTRAHLVLFCANTPFKQKVVASKVKFKRNPKHKGREQ |
| Ga0209191_10763762 | 3300027969 | Freshwater Lake | MKITIKVPKQVRAHIVLFCKDTPFKQKVVQSKKQFKRQPKHKGREQ |
| Ga0209191_11623444 | 3300027969 | Freshwater Lake | MKIVVKIPHKTRAHIVLFCAGTPFKQKVVASKIKFKRQPKHKG |
| Ga0209191_12415213 | 3300027969 | Freshwater Lake | MKITIRVPKQVRAHIVLFCKDTPFRQKVVESKVKYKRNPKHKGRDL |
| Ga0209401_10619382 | 3300027971 | Freshwater Lake | VKITIKIPKKHREHFVLFAQNTPFKQKVVESKVKYKRNPKHKGREQ |
| Ga0304729_10247882 | 3300028392 | Freshwater Lake | MKIVVKIPQKTRAHIVLFCAGTPFKQKVVQSKVKYTRQPKHRGKQND |
| Ga0304729_11083294 | 3300028392 | Freshwater Lake | IIKTYSKESEMKIVVKVPKQVRAHIVLFCKDTPFKQKVVQSKIKYKRQPKHKGKHND |
| Ga0304728_11200371 | 3300028393 | Freshwater Lake | TMKITIKVPKQVRAHIVLFCKDTPFKQKRVESKVKFKRQPKHKGREQ |
| Ga0304728_11257241 | 3300028393 | Freshwater Lake | IKVPKQVRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGREQ |
| Ga0304730_100901616 | 3300028394 | Freshwater Lake | MKIVVKIPQKTRAHLVLFCANTPFKQKRVESKKQYKRNPKHKGTPNAD |
| Ga0316219_10075364 | 3300031759 | Freshwater | MKIVIKVPRKTRAHFVLFSENTPFKPKVVKSKVLYKRNKKHKGRDYE |
| Ga0316219_11533423 | 3300031759 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKRVESKVLYKRNKKHKGREE |
| Ga0316219_13329381 | 3300031759 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYEXLG |
| Ga0315900_1002869113 | 3300031787 | Freshwater | VKITVKIPKQVRAHIVLFCKDTPFKQKVVASKIKYKRNPKHKGARHAD |
| Ga0316220_10548204 | 3300031884 | Freshwater | MKIVIKVPRKTRAHFVLFAENTPFKPKVVKSKKEYTRKQKHKGRDV |
| Ga0315901_103513054 | 3300031963 | Freshwater | VKITVKIPKQVRAHIVLFCKDTPFKQKVVASKIKYKRNPKHK |
| Ga0316218_10783404 | 3300032117 | Freshwater | MKIVIKVPQKTRAHFVLFAENTPFKPKKVESKVLYKRNKKHKGRDYE |
| Ga0316222_13142401 | 3300032561 | Freshwater | MKIVIKIPKKHREHFVLFAQNTPFKQKVVESKLLYKRNKKHKGRDYEXLGS |
| Ga0316225_10158089 | 3300032675 | Freshwater | VKIIIKVPKKHREHFVLFAQNTPFKPKKVESKIKYKRNPKHKGREL |
| Ga0316224_10845131 | 3300032753 | Freshwater | KMKIVIKVPRKTRAHFVLFAENTPFKPKVVKSKKEYTRKQKHKGRDV |
| Ga0334980_0014629_1696_1839 | 3300033816 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKIQYKRQPKHKGQHND |
| Ga0334992_0019383_911_1051 | 3300033992 | Freshwater | MKIVIKIPKQIRAHIVLFCKDTPFKQKVVQSKKQFKRNPKHKGREQ |
| Ga0334996_0007644_293_436 | 3300033994 | Freshwater | MKITIKVKPKHRKHIVLFCAGTPFKQKVVESKIKYKRNPKHKGQHND |
| Ga0334991_0007586_4619_4759 | 3300034013 | Freshwater | MKITIKVPKKHRQHIVLFCAGTPFKQKVVQSKIKYKRNPKHKGREQ |
| Ga0335000_0249969_355_498 | 3300034063 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVESKVKYKRQPKHKGQHND |
| Ga0335020_0002788_5072_5212 | 3300034082 | Freshwater | MKIVVKIPQKTRAHIVLFCAGTPFKQKRVESKMQYKRNPKHKGREQ |
| Ga0335020_0057111_64_204 | 3300034082 | Freshwater | MKIVVKIPQKTRAHIVLFCANTPFKQKVVESKKQFKRNPKHKGREQ |
| Ga0335020_0184737_742_882 | 3300034082 | Freshwater | MKITIKVPKKHRQHIVLFCAGTPFLQKVVQSKIKYKRNPKHKGREQ |
| Ga0335012_0386593_581_685 | 3300034093 | Freshwater | MKITIKVKPKHREHIVLFCAGTPFKQKVVESKVKY |
| Ga0335029_0087364_45_191 | 3300034102 | Freshwater | MKIVIKVPKQVRAHIVLFCKDTPFKQKVVASKVKFKRNPKHKGARNAD |
| Ga0335037_0422100_2_127 | 3300034107 | Freshwater | MKITIKVPKKHRQHIVLFCAGTPFKQKVVQSKIKYKRNPKHK |
| Ga0335033_0042811_2492_2635 | 3300034117 | Freshwater | MKITIKVPKKHREHIILFCAGTPFKQKVVNSKIQYRRQPKHKGQHND |
| Ga0335058_0193328_1_156 | 3300034121 | Freshwater | RQELSMKIVIKIPKQIRAHIVLFCKDTPFKQKVVQSKKQFKRNPKHKGREQ |
| ⦗Top⦘ |