Scaffold Ga0171462_1021

Overview

Basic Information

• Taxon OID: 3300013250
• Scaffold ID: Ga0171462_1021
• Source Dataset Name: Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Universidade Estadual de Campinas
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 141297
• Total Scaffold Genes: 110
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 89 (80.91%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rizhosphere → Microbial Communities Associated With Sugarcane

Source Dataset Sampling Location

• Location Name: Campinas, S?o Paulo, Brazil
• Coordinates
  • Lat. (^o): -22.8187222
  • Long. (^o): -47.05896667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085519	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0171462_1021105	F085519	N/A	MINRRFMIVPPALSSGGQTEKARQTSPEFLCLQLETANMRVERI*