x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300013250
3300013250: Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05
Overview
| Basic Information |
| IMG/M Taxon OID | 3300013250 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0127537 | Gp0196880 | Ga0171462 |
| Sample Name | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Universidade Estadual de Campinas |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 11179772 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Microbial Communities Associated With Sugarcane |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rizhosphere → Microbial Communities Associated With Sugarcane |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | terrestrial biome → rhizosphere → soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information |
| Location | Campinas, S?o Paulo, Brazil |
| Coordinates | Lat. (o) | -22.8187222 | Long. (o) | -47.05896667 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F085519 | Metagenome | 111 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0171462_1021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea | 141297 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0171462_1021 | Ga0171462_1021105 | F085519 | MINRRFMIVPPALSSGGQTEKARQTSPEFLCLQLETANMRVERI* |
