NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172363_10012370

Scaffold Ga0172363_10012370


Overview

Basic Information
Taxon OID3300013130 Open in IMG/M
Scaffold IDGa0172363_10012370 Open in IMG/M
Source Dataset NameSediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)6723
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (23.53%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameRwanda: Western Province, Lake Kivu
CoordinatesLat. (o)-2.05Long. (o)29.2062Alt. (m)Depth (m)388
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088534Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0172363_100123701F088534GAGMFSVTLTNPQSFGATYQRAILAVLPMDSDKNRHGLNSPEIKSALGLSNAARTSLCLMMKEMAHKGLVQRYEYKIGNRRIVSYKRLLPLRKREILSRWI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.