Scaffold Ga0157150_1133309

Overview

Basic Information

• Taxon OID: 3300012992
• Scaffold ID: Ga0157150_1133309
• Source Dataset Name: Pig viral communities from ears skin of healthy adult pig - Individual 0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Autonomous University of Barcelona
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctjsp22 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Skin → Unclassified → Unclassified → Pig Ears Skin → Pig Viral Communities From Oral Cavities And Ears Of Healthy Adults Pigs From Denmark

Source Dataset Sampling Location

• Location Name: Denmark
• Coordinates
  • Lat. (^o): 56.0
  • Long. (^o): 10.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157150_11333092	F036964	GGAGG	MMILKIIFPLLMVIGALGSLIVEVANKGDWATALQWIGACLLYTALTFRNIR*