| Basic Information | |
|---|---|
| Taxon OID | 3300012992 Open in IMG/M |
| Scaffold ID | Ga0157150_1015612 Open in IMG/M |
| Source Dataset Name | Pig viral communities from ears skin of healthy adult pig - Individual 0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Autonomous University of Barcelona |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1178 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Skin → Unclassified → Unclassified → Pig Ears Skin → Pig Viral Communities From Oral Cavities And Ears Of Healthy Adults Pigs From Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark | |||||||
| Coordinates | Lat. (o) | 56.0 | Long. (o) | 10.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053097 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157150_10156124 | F053097 | N/A | PPFKDFYNKSKDKQDAIKKIEFIIWRYKWNTPYEAYPEKERTWRVAKDVFNDENYVPDADVQELAKRFNEF* |
| ⦗Top⦘ |