Scaffold Ga0168315_110421

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0168315_110421

Scaffold Ga0168315_110421

Overview

Basic Information
Taxon OID	3300012980 Open in IMG/M
Scaffold ID	Ga0168315_110421 Open in IMG/M
Source Dataset Name	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	911
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings → Weathered Mine Tailings Microbial Communities From Hibbing, Minnesota, Usa

Source Dataset Sampling Location
Location Name	Hibbing, MN, USA
Coordinates	Lat. (^o)	47.432362	Long. (^o)	-92.940835	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015647	Metagenome / Metatranscriptome	253	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0168315_1104211	F015647	AGGAG	MGEAGTITNEELAILCDIVSGWSMKWAENLSADKRVALDHLIAGGFVEPKDELSFTKYQHTAKTELLFAQLCVGISGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.