NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137404_10035739

Scaffold Ga0137404_10035739


Overview

Basic Information
Taxon OID3300012929 Open in IMG/M
Scaffold IDGa0137404_10035739 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3713
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002396Metagenome / Metatranscriptome564Y
F004392Metagenome / Metatranscriptome440N
F066496Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0137404_100357391F066496AGAAGVVLIVALVLGAFVDRITALKIAAGVVLLWTLQNQPVVFECIRKLFSFVQRRPSVREY
Ga0137404_100357392F004392AGGAMPVNGPETIADSKPSQPVPSEGRSVRAARNAKPAVGRGASTRRRRDRQDSSETNGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLHKVTEFQTRADIGRSGEPILRKETLKKNNPAS*
Ga0137404_100357393F002396GAGGMRSLFPSTYDRADVLMSAGCSTFVSAALILVIPRVGIVLLEILLGLFFIGCALAARARLRIQARSQVKEGPEGSTNAKAKWFDRYDVLMILIVIVIYSSVPRLLRGAGLSDGTVGILPLILFAAGILLKPRAVQFIERRRKDRKAETHDGRPHMDAGEKQEIARKETVERCQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.