| Basic Information | |
|---|---|
| Taxon OID | 3300012928 Open in IMG/M |
| Scaffold ID | Ga0163110_10317466 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1145 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Costa Rica: the Eastern Pacific | |||||||
| Coordinates | Lat. (o) | 2.0416 | Long. (o) | -97.0511 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034206 | Metagenome / Metatranscriptome | 175 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0163110_103174661 | F034206 | N/A | LELKRPRKKLCPKLEKNVNMKPNIITFLFKVRLIIYEL* |
| ⦗Top⦘ |