| Basic Information | |
|---|---|
| Family ID | F034206 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LIGALNNPKKKLCPKLEKNVNINPNIITFLFKERLIIYEL |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 94.86 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.429 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF03446 | NAD_binding_2 | 58.86 |
| PF14833 | NAD_binding_11 | 29.14 |
| PF12766 | Pyridox_oxase_2 | 5.71 |
| PF01075 | Glyco_transf_9 | 1.14 |
| PF05050 | Methyltransf_21 | 1.14 |
| PF00132 | Hexapep | 1.14 |
| PF03328 | HpcH_HpaI | 0.57 |
| PF07690 | MFS_1 | 0.57 |
| PF00268 | Ribonuc_red_sm | 0.57 |
| PF14099 | Polysacc_lyase | 0.57 |
| PF02515 | CoA_transf_3 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.57 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.57 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.57 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.57 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.43 % |
| All Organisms | root | All Organisms | 32.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001967|GOS2242_1080422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1721 | Open in IMG/M |
| 3300001974|GOS2246_10077682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1463 | Open in IMG/M |
| 3300002033|GOS24894_10404109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1313 | Open in IMG/M |
| 3300002033|GOS24894_10526064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1313 | Open in IMG/M |
| 3300005523|Ga0066865_10240311 | Not Available | 682 | Open in IMG/M |
| 3300005523|Ga0066865_10341387 | Not Available | 568 | Open in IMG/M |
| 3300005606|Ga0066835_10045456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
| 3300005960|Ga0066364_10022468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1945 | Open in IMG/M |
| 3300005960|Ga0066364_10052562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1320 | Open in IMG/M |
| 3300005960|Ga0066364_10204034 | Not Available | 686 | Open in IMG/M |
| 3300005960|Ga0066364_10276914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 587 | Open in IMG/M |
| 3300005971|Ga0066370_10017719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 2012 | Open in IMG/M |
| 3300005971|Ga0066370_10241975 | Not Available | 638 | Open in IMG/M |
| 3300006337|Ga0068495_1713781 | Not Available | 587 | Open in IMG/M |
| 3300007291|Ga0066367_1453774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 518 | Open in IMG/M |
| 3300007992|Ga0105748_10232582 | Not Available | 771 | Open in IMG/M |
| 3300008097|Ga0111541_10004348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4927 | Open in IMG/M |
| 3300008097|Ga0111541_10145151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 978 | Open in IMG/M |
| 3300008097|Ga0111541_10553245 | Not Available | 509 | Open in IMG/M |
| 3300009058|Ga0102854_1151707 | Not Available | 664 | Open in IMG/M |
| 3300009104|Ga0117902_1817533 | Not Available | 523 | Open in IMG/M |
| 3300009172|Ga0114995_10144159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
| 3300009173|Ga0114996_11031653 | Not Available | 583 | Open in IMG/M |
| 3300009420|Ga0114994_10793719 | Not Available | 615 | Open in IMG/M |
| 3300009422|Ga0114998_10345535 | Not Available | 696 | Open in IMG/M |
| 3300009425|Ga0114997_10304012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 882 | Open in IMG/M |
| 3300009432|Ga0115005_11309713 | Not Available | 591 | Open in IMG/M |
| 3300009476|Ga0115555_1188973 | Not Available | 852 | Open in IMG/M |
| 3300009481|Ga0114932_10669397 | Not Available | 605 | Open in IMG/M |
| 3300009512|Ga0115003_10324242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 910 | Open in IMG/M |
| 3300009512|Ga0115003_10529323 | Not Available | 689 | Open in IMG/M |
| 3300009512|Ga0115003_10563278 | Not Available | 665 | Open in IMG/M |
| 3300009512|Ga0115003_10630802 | Not Available | 625 | Open in IMG/M |
| 3300009512|Ga0115003_10655553 | Not Available | 612 | Open in IMG/M |
| 3300009512|Ga0115003_10734725 | Not Available | 574 | Open in IMG/M |
| 3300009512|Ga0115003_10776222 | Not Available | 557 | Open in IMG/M |
| 3300009512|Ga0115003_10785949 | Not Available | 553 | Open in IMG/M |
| 3300009526|Ga0115004_10977425 | Not Available | 507 | Open in IMG/M |
| 3300009593|Ga0115011_11588039 | Not Available | 581 | Open in IMG/M |
| 3300009703|Ga0114933_10013247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 6730 | Open in IMG/M |
| 3300009703|Ga0114933_10099801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2042 | Open in IMG/M |
| 3300009703|Ga0114933_10950424 | Not Available | 545 | Open in IMG/M |
| 3300009705|Ga0115000_10425767 | Not Available | 843 | Open in IMG/M |
| 3300009785|Ga0115001_10605833 | Not Available | 669 | Open in IMG/M |
| 3300010151|Ga0098061_1318552 | Not Available | 533 | Open in IMG/M |
| 3300010883|Ga0133547_10049483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 9877 | Open in IMG/M |
| 3300010883|Ga0133547_10133208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5429 | Open in IMG/M |
| 3300010883|Ga0133547_10141894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5227 | Open in IMG/M |
| 3300012414|Ga0138264_1831407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 933 | Open in IMG/M |
| 3300012419|Ga0138260_10637683 | Not Available | 706 | Open in IMG/M |
| 3300012919|Ga0160422_10406478 | Not Available | 849 | Open in IMG/M |
| 3300012919|Ga0160422_10489405 | Not Available | 773 | Open in IMG/M |
| 3300012919|Ga0160422_10641520 | Not Available | 675 | Open in IMG/M |
| 3300012919|Ga0160422_10793930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 607 | Open in IMG/M |
| 3300012919|Ga0160422_10836388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 592 | Open in IMG/M |
| 3300012919|Ga0160422_10985257 | Not Available | 545 | Open in IMG/M |
| 3300012919|Ga0160422_11149833 | Not Available | 504 | Open in IMG/M |
| 3300012928|Ga0163110_10317466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1145 | Open in IMG/M |
| 3300012928|Ga0163110_10429751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 995 | Open in IMG/M |
| 3300012928|Ga0163110_10829282 | Not Available | 729 | Open in IMG/M |
| 3300012928|Ga0163110_10930691 | Not Available | 689 | Open in IMG/M |
| 3300012928|Ga0163110_11502561 | Not Available | 547 | Open in IMG/M |
| 3300012936|Ga0163109_10799475 | Not Available | 689 | Open in IMG/M |
| 3300012952|Ga0163180_11772212 | Not Available | 524 | Open in IMG/M |
| 3300012953|Ga0163179_11464498 | Not Available | 613 | Open in IMG/M |
| 3300012954|Ga0163111_10829635 | Not Available | 882 | Open in IMG/M |
| 3300012954|Ga0163111_11288578 | Not Available | 716 | Open in IMG/M |
| 3300014030|Ga0116816_1009837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 942 | Open in IMG/M |
| 3300017724|Ga0181388_1138808 | Not Available | 579 | Open in IMG/M |
| 3300017725|Ga0181398_1096921 | Not Available | 704 | Open in IMG/M |
| 3300017726|Ga0181381_1100313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 613 | Open in IMG/M |
| 3300017733|Ga0181426_1101814 | Not Available | 577 | Open in IMG/M |
| 3300017765|Ga0181413_1267076 | Not Available | 502 | Open in IMG/M |
| 3300017767|Ga0181406_1092787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 917 | Open in IMG/M |
| 3300017769|Ga0187221_1114689 | Not Available | 815 | Open in IMG/M |
| 3300017769|Ga0187221_1173906 | Not Available | 630 | Open in IMG/M |
| 3300017770|Ga0187217_1195818 | Not Available | 668 | Open in IMG/M |
| 3300017783|Ga0181379_1140047 | Not Available | 867 | Open in IMG/M |
| 3300017952|Ga0181583_10249535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1145 | Open in IMG/M |
| 3300018426|Ga0181566_10720343 | Not Available | 685 | Open in IMG/M |
| 3300018876|Ga0181564_10602512 | Not Available | 582 | Open in IMG/M |
| 3300019459|Ga0181562_10325034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 759 | Open in IMG/M |
| 3300020266|Ga0211519_1050289 | Not Available | 816 | Open in IMG/M |
| 3300020270|Ga0211671_1041398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 884 | Open in IMG/M |
| 3300020289|Ga0211621_1027815 | Not Available | 851 | Open in IMG/M |
| 3300020293|Ga0211665_1011526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1902 | Open in IMG/M |
| 3300020297|Ga0211490_1063866 | Not Available | 630 | Open in IMG/M |
| 3300020309|Ga0211681_1046689 | Not Available | 727 | Open in IMG/M |
| 3300020320|Ga0211597_1066530 | Not Available | 671 | Open in IMG/M |
| 3300020351|Ga0211601_1158820 | Not Available | 500 | Open in IMG/M |
| 3300020362|Ga0211488_10154743 | Not Available | 642 | Open in IMG/M |
| 3300020370|Ga0211672_10107109 | Not Available | 850 | Open in IMG/M |
| 3300020374|Ga0211477_10072716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1306 | Open in IMG/M |
| 3300020377|Ga0211647_10215881 | Not Available | 617 | Open in IMG/M |
| 3300020382|Ga0211686_10410081 | Not Available | 547 | Open in IMG/M |
| 3300020400|Ga0211636_10360397 | Not Available | 549 | Open in IMG/M |
| 3300020401|Ga0211617_10243949 | Not Available | 746 | Open in IMG/M |
| 3300020404|Ga0211659_10468437 | Not Available | 541 | Open in IMG/M |
| 3300020404|Ga0211659_10528635 | Not Available | 501 | Open in IMG/M |
| 3300020411|Ga0211587_10417091 | Not Available | 543 | Open in IMG/M |
| 3300020414|Ga0211523_10270401 | Not Available | 698 | Open in IMG/M |
| 3300020418|Ga0211557_10226234 | Not Available | 866 | Open in IMG/M |
| 3300020419|Ga0211512_10061743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1785 | Open in IMG/M |
| 3300020420|Ga0211580_10161874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 931 | Open in IMG/M |
| 3300020420|Ga0211580_10171873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 900 | Open in IMG/M |
| 3300020420|Ga0211580_10212018 | Not Available | 800 | Open in IMG/M |
| 3300020420|Ga0211580_10243510 | Not Available | 741 | Open in IMG/M |
| 3300020420|Ga0211580_10258167 | Not Available | 717 | Open in IMG/M |
| 3300020424|Ga0211620_10325509 | Not Available | 654 | Open in IMG/M |
| 3300020440|Ga0211518_10431120 | Not Available | 604 | Open in IMG/M |
| 3300020442|Ga0211559_10449996 | Not Available | 592 | Open in IMG/M |
| 3300020445|Ga0211564_10275921 | Not Available | 830 | Open in IMG/M |
| 3300020446|Ga0211574_10520273 | Not Available | 510 | Open in IMG/M |
| 3300020450|Ga0211641_10353844 | Not Available | 712 | Open in IMG/M |
| 3300020451|Ga0211473_10355546 | Not Available | 751 | Open in IMG/M |
| 3300020452|Ga0211545_10371436 | Not Available | 651 | Open in IMG/M |
| 3300020452|Ga0211545_10570677 | Not Available | 507 | Open in IMG/M |
| 3300020457|Ga0211643_10295998 | Not Available | 795 | Open in IMG/M |
| 3300020461|Ga0211535_10589069 | Not Available | 512 | Open in IMG/M |
| 3300020465|Ga0211640_10228838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1042 | Open in IMG/M |
| 3300020465|Ga0211640_10320603 | Not Available | 858 | Open in IMG/M |
| 3300020468|Ga0211475_10253311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 873 | Open in IMG/M |
| 3300020469|Ga0211577_10165638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1479 | Open in IMG/M |
| 3300020469|Ga0211577_10566142 | Not Available | 681 | Open in IMG/M |
| 3300020471|Ga0211614_10137421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1047 | Open in IMG/M |
| 3300020473|Ga0211625_10650816 | Not Available | 508 | Open in IMG/M |
| 3300020474|Ga0211547_10094770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300020474|Ga0211547_10480894 | Not Available | 622 | Open in IMG/M |
| 3300020475|Ga0211541_10036781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2475 | Open in IMG/M |
| 3300021959|Ga0222716_10507765 | Not Available | 676 | Open in IMG/M |
| 3300021973|Ga0232635_1116793 | Not Available | 640 | Open in IMG/M |
| 3300022074|Ga0224906_1178937 | Not Available | 587 | Open in IMG/M |
| 3300022925|Ga0255773_10416091 | Not Available | 506 | Open in IMG/M |
| (restricted) 3300024261|Ga0233439_10350647 | Not Available | 618 | Open in IMG/M |
| 3300024344|Ga0209992_10041002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2273 | Open in IMG/M |
| 3300024344|Ga0209992_10445082 | Not Available | 505 | Open in IMG/M |
| 3300025667|Ga0209043_1112899 | Not Available | 704 | Open in IMG/M |
| 3300025890|Ga0209631_10532775 | Not Available | 514 | Open in IMG/M |
| 3300025897|Ga0209425_10302408 | Not Available | 801 | Open in IMG/M |
| 3300026076|Ga0208261_1125644 | Not Available | 656 | Open in IMG/M |
| 3300026086|Ga0207964_1086367 | Not Available | 722 | Open in IMG/M |
| 3300026203|Ga0207985_1035700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1267 | Open in IMG/M |
| 3300026257|Ga0208407_1141834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Candidatus Methylopumilus → Candidatus Methylopumilus planktonicus | 735 | Open in IMG/M |
| 3300026258|Ga0208130_1164583 | Not Available | 586 | Open in IMG/M |
| 3300026292|Ga0208277_1144619 | Not Available | 805 | Open in IMG/M |
| 3300026500|Ga0247592_1137065 | Not Available | 585 | Open in IMG/M |
| 3300027702|Ga0209036_1087597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 948 | Open in IMG/M |
| 3300027788|Ga0209711_10099492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1473 | Open in IMG/M |
| 3300027788|Ga0209711_10374819 | Not Available | 591 | Open in IMG/M |
| 3300027788|Ga0209711_10435608 | Not Available | 528 | Open in IMG/M |
| 3300027791|Ga0209830_10107785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1375 | Open in IMG/M |
| 3300027813|Ga0209090_10578069 | Not Available | 511 | Open in IMG/M |
| 3300027849|Ga0209712_10295036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 918 | Open in IMG/M |
| 3300027849|Ga0209712_10431957 | Not Available | 741 | Open in IMG/M |
| 3300028008|Ga0228674_1213297 | Not Available | 615 | Open in IMG/M |
| 3300028197|Ga0257110_1045797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1913 | Open in IMG/M |
| 3300028287|Ga0257126_1268203 | Not Available | 500 | Open in IMG/M |
| 3300031519|Ga0307488_10575483 | Not Available | 658 | Open in IMG/M |
| 3300031598|Ga0308019_10282169 | Not Available | 623 | Open in IMG/M |
| 3300031630|Ga0308004_10164388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 921 | Open in IMG/M |
| 3300031644|Ga0308001_10056589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1686 | Open in IMG/M |
| 3300031644|Ga0308001_10076319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1426 | Open in IMG/M |
| 3300031695|Ga0308016_10042520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1951 | Open in IMG/M |
| 3300031695|Ga0308016_10180659 | Not Available | 819 | Open in IMG/M |
| 3300031696|Ga0307995_1268198 | Not Available | 578 | Open in IMG/M |
| 3300031721|Ga0308013_10057088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1594 | Open in IMG/M |
| 3300031721|Ga0308013_10233782 | Not Available | 666 | Open in IMG/M |
| 3300031721|Ga0308013_10348508 | Not Available | 510 | Open in IMG/M |
| 3300031766|Ga0315322_10312988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 1070 | Open in IMG/M |
| 3300031773|Ga0315332_10823696 | Not Available | 562 | Open in IMG/M |
| 3300031775|Ga0315326_10379745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 | 919 | Open in IMG/M |
| 3300032011|Ga0315316_10962856 | Not Available | 696 | Open in IMG/M |
| 3300032047|Ga0315330_10696860 | Not Available | 592 | Open in IMG/M |
| 3300032073|Ga0315315_11240310 | Not Available | 658 | Open in IMG/M |
| 3300032073|Ga0315315_11292178 | Not Available | 641 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 28.57% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 28.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.29% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.71% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.57% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 4.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.43% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.71% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.14% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.14% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.14% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.57% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.57% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.57% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.57% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.57% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.57% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.57% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300007291 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012414 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014030 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020266 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
| 3300020293 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556092-ERR599063) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020309 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX556064-ERR599104) | Environmental | Open in IMG/M |
| 3300020320 | Marine microbial communities from Tara Oceans - TARA_B000000441 (ERX556072-ERR598990) | Environmental | Open in IMG/M |
| 3300020351 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX555955-ERR599089) | Environmental | Open in IMG/M |
| 3300020362 | Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021973 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmer | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026086 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026203 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027702 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031721 | Marine microbial communities from water near the shore, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2242_10804221 | 3300001967 | Marine | LIGALNNPKKKLCPKLEKNVKIKPYNNTFLFIERLIIYEL* |
| GOS2246_100776823 | 3300001974 | Marine | MSNSFLIGALNNPKKKLCPKLEKNVKIKPNKTTFLLRERLIIYEL* |
| GOS24894_104041093 | 3300002033 | Marine | PSSSLNGALNKPKKKLCPKLEKNVKINPKIITFLFRERFIIYEL |
| GOS24894_105260643 | 3300002033 | Marine | PSSSLNGALNKPKKKLCPKLEKNVKINPKIITFLFRERFIIYEL* |
| Ga0066865_102403111 | 3300005523 | Marine | FLIGALNNPKKKLCPKLEKNVNMNPNIITFLFNVRLIINEL* |
| Ga0066865_103413871 | 3300005523 | Marine | IGALNNPKKKLCPKLEKNVNIKPNIITFLFNERLIINEL* |
| Ga0066835_100454561 | 3300005606 | Marine | IGALNNPKKKLCPKLEKNVNMNPNIITFLLRERLIIYEL* |
| Ga0066364_100224681 | 3300005960 | Marine | SSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL* |
| Ga0066364_100525623 | 3300005960 | Marine | NPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL* |
| Ga0066364_102040342 | 3300005960 | Marine | NNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL* |
| Ga0066364_102769142 | 3300005960 | Marine | FLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDV* |
| Ga0066370_100177194 | 3300005971 | Marine | IPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDV* |
| Ga0066370_102419751 | 3300005971 | Marine | LIGALNNPKKKLCPKLEKNVNINPNIITFLFKLRFIINEL* |
| Ga0068495_17137811 | 3300006337 | Marine | IPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDL* |
| Ga0066367_14537742 | 3300007291 | Marine | MLGLKIPKKKLCPKLEKNVKINPNIITFLFKEKLIIYEL* |
| Ga0105748_102325821 | 3300007992 | Estuary Water | LPNCPWVISNSFLIGALNNPKKKLCPKLEKNVKIKPNIITFLFNERLIIYE* |
| Ga0111541_100043482 | 3300008097 | Marine | MLGLNSPRKKLCPKLEKNVNIKPNKRTFLFKVKLII* |
| Ga0111541_101451512 | 3300008097 | Marine | VISNSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL* |
| Ga0111541_105532452 | 3300008097 | Marine | LIGALNNPKKKLCPKLEKNVNINPNIITFLFKERLIIYEL* |
| Ga0102854_11517072 | 3300009058 | Estuarine | GALNKPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL* |
| Ga0117902_18175331 | 3300009104 | Marine | LIGALNNPRKKLCPKLEKNVKIKPNIIIFLFKERLIIYEL* |
| Ga0114995_101441591 | 3300009172 | Marine | LPNCPWVISNSFLIGALNKPKKKLCPKLEKNVNINPYAITLLFNDKLFIYEL* |
| Ga0114996_110316531 | 3300009173 | Marine | GALNNPKKKLCPKLEKNVNIKPNIIIFLFRERLIIYEL* |
| Ga0114994_107937192 | 3300009420 | Marine | IGALNKPKKKLCPKLEKNVNINPNIIIFLFKERLIIYEL* |
| Ga0114998_103455351 | 3300009422 | Marine | NPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL* |
| Ga0114997_103040121 | 3300009425 | Marine | LNNPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL* |
| Ga0115005_113097132 | 3300009432 | Marine | LNNPKKKLCPKLEKNVNMKPNIITFLFNEMLIIYEL* |
| Ga0115555_11889731 | 3300009476 | Pelagic Marine | NNPKKKLCPKLEKNVKIKPNIITFLFNERLIIYE* |
| Ga0114932_106693972 | 3300009481 | Deep Subsurface | LIGALNNPKKKLCPKLEKNVKIKPNIIIFLFKERLIIYEL* |
| Ga0115003_103242421 | 3300009512 | Marine | SFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFNKRLIIYEL* |
| Ga0115003_105293232 | 3300009512 | Marine | FLIGALNKPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL* |
| Ga0115003_105632781 | 3300009512 | Marine | LNNPKKKLCPKLEKNVNINPKIITFLFNERLIIYEL* |
| Ga0115003_106308021 | 3300009512 | Marine | NKPRKKLCPKLEKNVNIKPNIIIFLFRERLIIYEL* |
| Ga0115003_106555532 | 3300009512 | Marine | FLIGALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL* |
| Ga0115003_107347252 | 3300009512 | Marine | GALNKPRKKLCPKLEKNVNIKPNIIIFLFRERFIIYEL* |
| Ga0115003_107762221 | 3300009512 | Marine | ALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL* |
| Ga0115003_107859492 | 3300009512 | Marine | LNNPRKKLCPKLEKNVNMNPNIITFLFKERLIIYEL* |
| Ga0115004_109774252 | 3300009526 | Marine | CVMPSSFLIGALNKPRKKLCPKLEKNVNIKPNIIIFLFRERFIIYEL* |
| Ga0115011_115880391 | 3300009593 | Marine | SSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRFIINEL* |
| Ga0114933_100132471 | 3300009703 | Deep Subsurface | FLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLNINEL* |
| Ga0114933_100998011 | 3300009703 | Deep Subsurface | IPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL* |
| Ga0114933_109504241 | 3300009703 | Deep Subsurface | FLIGALNNPRKKLCPKLEKNVNIKPNIITFLLKESLIIYEL* |
| Ga0115000_104257671 | 3300009705 | Marine | IGALNNPKKKLCPKLEKNVNIKPNIIIFLLRGRLIIYEF* |
| Ga0115001_106058331 | 3300009785 | Marine | SSFLIGALNKPRKKLCPKLEKNVNIKPNIIIFLFRERLIIYEL* |
| Ga0098061_13185521 | 3300010151 | Marine | WPCVIPSSFLIGALNNPKKKLCPKLEKNVKINPNIITFLFKERLIIYEL* |
| Ga0133547_1004948314 | 3300010883 | Marine | CVMPSSFLIGALNKPRKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL* |
| Ga0133547_101332081 | 3300010883 | Marine | NNPKKKLCPKLEKNVNINPNIIIFLFKERLIIYEF* |
| Ga0133547_101418948 | 3300010883 | Marine | SLLIGALNNPKKKLCPKLEKNVNINPNIIIFLFKERLIIYE* |
| Ga0138264_18314072 | 3300012414 | Polar Marine | ILELKRPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL* |
| Ga0138260_106376831 | 3300012419 | Polar Marine | LIGALNKPRKKLCPKLEKNVNIKPNIIIFLFKERLIIYE* |
| Ga0160422_104064781 | 3300012919 | Seawater | ALNNPKKKLCPKLEKNVNINPNIITFLLRERLIIYEL* |
| Ga0160422_104894051 | 3300012919 | Seawater | IPSSFLIGALNNPKKKLCPKLEKNVNMKPNIITFLLIERLIIYDL* |
| Ga0160422_106415202 | 3300012919 | Seawater | PSSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIIDEL* |
| Ga0160422_107939301 | 3300012919 | Seawater | PSSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL* |
| Ga0160422_108363881 | 3300012919 | Seawater | NNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDV* |
| Ga0160422_109852572 | 3300012919 | Seawater | EPNCPCEIFRSFLMLGLNNPKKKLCPKLEKNVNINPNIITFLFKLRLIIGDL* |
| Ga0160422_111498331 | 3300012919 | Seawater | NPKKKLCPKLEKNVNINPNIITFLFIERFIIYDL* |
| Ga0163110_103174661 | 3300012928 | Surface Seawater | LELKRPRKKLCPKLEKNVNMKPNIITFLFKVRLIIYEL* |
| Ga0163110_104297511 | 3300012928 | Surface Seawater | LNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDV* |
| Ga0163110_108292822 | 3300012928 | Surface Seawater | SFRIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYEL* |
| Ga0163110_109306912 | 3300012928 | Surface Seawater | VIPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIESLIIYEL* |
| Ga0163110_115025611 | 3300012928 | Surface Seawater | ASLILELNRPRKKLCPKLEKNVKIKPNKITFLFKERLIIYEL* |
| Ga0163109_107994752 | 3300012936 | Surface Seawater | ILSLNKPKKKLCPKLEKNVNINPKIIIFLLKVRFIII* |
| Ga0163180_117722122 | 3300012952 | Seawater | GALNNPKKKLCPKLEKNVNIKPNIITFLLKERLIIYEL* |
| Ga0163179_114644981 | 3300012953 | Seawater | VMPNSFLIGALNNPRKKLCPKLEKNVNMKPNIITFLFNERLIIYEL* |
| Ga0163111_108296352 | 3300012954 | Surface Seawater | SFLIGALNNPKKKLCPKLEKNVKINPKKITFLFKERLIIYEL* |
| Ga0163111_112885782 | 3300012954 | Surface Seawater | LIGALNNPKKKLCPKLEKNVKINPKIITFLFKEKLIIYDL* |
| Ga0116816_10098371 | 3300014030 | Marine | ALNNPKKKLCPKLEKNVNMKPNIITFLFIERLIIYEL* |
| Ga0181388_11388082 | 3300017724 | Seawater | FLIGALNNPRKKLCPKLEKNVNMKPNIITFLFNERLIIYEL |
| Ga0181398_10969212 | 3300017725 | Seawater | LNNPKKKLCPKLEKNVNMKPNIITFLFNERLIIYEL |
| Ga0181381_11003131 | 3300017726 | Seawater | PSSFLIGALNNPKKKLCPKLEKNVNIKPYIITFLFNVRLIINEL |
| Ga0181426_11018142 | 3300017733 | Seawater | NSFLIGALNNPKKKLCPKLEKNVNMKPNIITFLFNERLIIYEL |
| Ga0181413_12670761 | 3300017765 | Seawater | PCVIPNSFLIGALNKPRKKLCPKLEKNVNINPNIITFLFNVRLIINEL |
| Ga0181406_10927872 | 3300017767 | Seawater | FLIGALNNPKKKLCPKLEKNVNMNPNIITFLFKERLIIYEL |
| Ga0187221_11146892 | 3300017769 | Seawater | FLIGALNNPRKKLCPKLEKKVNINPNKITLKFIFLNISEKQFRLRKI |
| Ga0187221_11739062 | 3300017769 | Seawater | RSGKGPKKKLCPKLEKNVNIKPNIITFLFNERLIINEL |
| Ga0187217_11958182 | 3300017770 | Seawater | SFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFNVRLIINEL |
| Ga0181379_11400472 | 3300017783 | Seawater | WVIPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL |
| Ga0181583_102495353 | 3300017952 | Salt Marsh | LNSSLIGALKSTKKKLCPTLEKNVNINPKVITLVLIEGLNIYE |
| Ga0181566_107203432 | 3300018426 | Salt Marsh | ALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEF |
| Ga0181564_106025122 | 3300018876 | Salt Marsh | LIGALNNPKKKLCPKLEKNVNMNPNIITFLFNVRLIIYEL |
| Ga0181562_103250342 | 3300019459 | Salt Marsh | IGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL |
| Ga0211519_10502891 | 3300020266 | Marine | VIPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL |
| Ga0211671_10413981 | 3300020270 | Marine | GALNKPKKKLCPKLEKNVNINPKIITFLFKLRLIINEL |
| Ga0211621_10278152 | 3300020289 | Marine | IGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYEL |
| Ga0211665_10115261 | 3300020293 | Marine | GALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL |
| Ga0211490_10638661 | 3300020297 | Marine | NSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFTERLIIYEL |
| Ga0211681_10466891 | 3300020309 | Marine | PSSFLIGALNKPKKKLCPKLEKNVNMKPNIIIFLFKERLIIYEL |
| Ga0211597_10665301 | 3300020320 | Marine | SFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYEL |
| Ga0211601_11588201 | 3300020351 | Marine | WVIPNSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIINVL |
| Ga0211488_101547432 | 3300020362 | Marine | EISSSVLIGALNKPKKKLCPKLEKNVNMNPKTTTFLFIEILNIYD |
| Ga0211672_101071092 | 3300020370 | Marine | LNNPKKKLCPKLEKNVNINPNNKTFLFKLRLIIYE |
| Ga0211477_100727161 | 3300020374 | Marine | FLMLVLNNPKKKLCPKLEKNVNINPNKIIFLFKLRLFIYVM |
| Ga0211647_102158811 | 3300020377 | Marine | SSFLIGALNNPKKKLCPKLEKNVNINPKIITFLFNVRLIINEL |
| Ga0211686_104100812 | 3300020382 | Marine | SFLIGALNKPRKKLCPKLEKNVNINPKIITFLFNVRLIIYEL |
| Ga0211636_103603971 | 3300020400 | Marine | NNPKKKLCPKLEKNVKINPKKITFLFKERLIIYEL |
| Ga0211617_102439492 | 3300020401 | Marine | NSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFIERLIIYDL |
| Ga0211659_104684371 | 3300020404 | Marine | LIGALNNPKKKLCPKLEKNVKINPKIITFLFKESLIIYEL |
| Ga0211659_105286351 | 3300020404 | Marine | SSRIGALNNPRKKLCPKLEKNVKIKPNKITFLFKERLIIYEL |
| Ga0211587_104170912 | 3300020411 | Marine | SFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFIERLIIYEL |
| Ga0211523_102704011 | 3300020414 | Marine | FLIGALNNPKKKLCPKLEKNVKINPKIITFLFKESLIIYEL |
| Ga0211557_102262342 | 3300020418 | Marine | IGALNNPKKKLCPKLEKNVKIKPNIIIFLFKEKFVIYEF |
| Ga0211512_100617431 | 3300020419 | Marine | NSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0211580_101618742 | 3300020420 | Marine | LIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDV |
| Ga0211580_101718731 | 3300020420 | Marine | ALNNPKKKLCPKLEKNVNINPNIITFLFNLRLIINEL |
| Ga0211580_102120181 | 3300020420 | Marine | LIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYDL |
| Ga0211580_102435101 | 3300020420 | Marine | SSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFNVRLIINEL |
| Ga0211580_102581671 | 3300020420 | Marine | LIGALNNPRKKLCPKLEKNVNMNPNIITFLFKERLIINEL |
| Ga0211620_103255092 | 3300020424 | Marine | IGALNNPKKKLCPKLEKNVNIKPNIITFLFIERLIIYEL |
| Ga0211518_104311202 | 3300020440 | Marine | NNPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0211559_104499961 | 3300020442 | Marine | NNPKKKLCPKLEKNVNINPNIITFLFRERLIIYEL |
| Ga0211564_102759211 | 3300020445 | Marine | SSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL |
| Ga0211574_105202731 | 3300020446 | Marine | WEIPSSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYEL |
| Ga0211641_103538442 | 3300020450 | Marine | PNSFLIGALNKPKKKLCPKLEKNVNIKPKIITFLFNERLIINEL |
| Ga0211473_103555461 | 3300020451 | Marine | SFLIGALNNPRKKLCPKLEKNVNINPNIITFLFKERLIIYDL |
| Ga0211545_103714361 | 3300020452 | Marine | NNPRKKLCPKLEKNVNINPNIITFLLKENLIIYEL |
| Ga0211545_105706772 | 3300020452 | Marine | NSFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0211643_102959982 | 3300020457 | Marine | SFLIGALNNPKKKLCPKLEKNVKINPKRITFLFKERLIIYEL |
| Ga0211535_105890692 | 3300020461 | Marine | CDISSSFLILGLNRPRKKLCPKLEKNVNINPNNKIFLFKLRLIIYE |
| Ga0211640_102288381 | 3300020465 | Marine | SFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL |
| Ga0211640_103206031 | 3300020465 | Marine | PXVIPNSFLIGALNNPKKKLCPKLEKNVKIKPKIITFLFKEKLIIYDL |
| Ga0211475_102533111 | 3300020468 | Marine | NSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFSER |
| Ga0211577_101656381 | 3300020469 | Marine | PNSFLIGALNNPRKKLCPKLEKNVKIKPKIITFLLKERLIIYEL |
| Ga0211577_105661421 | 3300020469 | Marine | LIGALNNPKKKLCPKLEKNVNINPNIITFLFNERLIIYEL |
| Ga0211614_101374211 | 3300020471 | Marine | NSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFKERLIIYEL |
| Ga0211625_106508162 | 3300020473 | Marine | LSLNKPKKKLCPKLEKNVNINPKIIIFLFKVRFIII |
| Ga0211547_100947703 | 3300020474 | Marine | EISNSFRIGALNNPKKKLCPKLEKNVKIKPKIITFLFKEILIIYEL |
| Ga0211547_104808942 | 3300020474 | Marine | IPNSFLIGALNNPRKKLCPKLEKNVNINPNIITFLFNKVLIIYEL |
| Ga0211541_100367815 | 3300020475 | Marine | WCVKQSQKKLCPKLEKNVNINPNTITFLFKERLIINEL |
| Ga0222716_105077652 | 3300021959 | Estuarine Water | ISALNNPKKKLCPKLEKNVKIKPNIITFLFNERLIIYE |
| Ga0232635_11167932 | 3300021973 | Hydrothermal Vent Fluids | GALNNPKKKLCPKLEKNVNINPNIITFLFIERLIIYEL |
| Ga0224906_11789372 | 3300022074 | Seawater | PNSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0255773_104160912 | 3300022925 | Salt Marsh | PSSFLIGALNNPKKKLCPKLEKNVNINPNIITFLFNVRLIINEL |
| (restricted) Ga0233439_103506471 | 3300024261 | Seawater | SSFLIGALNNPKKKLCPKLEKNVNIKPKIITFLFNERLIIYEL |
| Ga0209992_100410021 | 3300024344 | Deep Subsurface | ILSLNNPKKKLCPKLEKNVNINPNIITFLFKLRLIIYE |
| Ga0209992_104450821 | 3300024344 | Deep Subsurface | LIGALNNPKKKLCPKLEKNVKIKPNIIIFLFKERLIIYEL |
| Ga0209043_11128991 | 3300025667 | Marine | VIPNSFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0209631_105327751 | 3300025890 | Pelagic Marine | FLIGALNNPKKKLCPKLEKNVNINPNIIIFLFNLRLIISEL |
| Ga0209425_103024082 | 3300025897 | Pelagic Marine | ILSSFLIGALNKPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0208261_11256441 | 3300026076 | Marine | NNPKKKLCPKLEKNVNINPNIITFLFKERLIIYEL |
| Ga0207964_10863671 | 3300026086 | Marine | IGALNNPKKKLCPKLEKNVKINPNIITFLFKERLIIYEL |
| Ga0207985_10357001 | 3300026203 | Marine | GALNNPKKKLCPKLEKNVNMKPNIITFLLRERLIIYEL |
| Ga0208407_11418341 | 3300026257 | Marine | NKPRKKLCPKLEKNVNINPNIITFLFNEELIIYEL |
| Ga0208130_11645832 | 3300026258 | Marine | LNRPKKKLCPKLEKNVKINPKKITFLFKESLIIYEL |
| Ga0208277_11446192 | 3300026292 | Marine | ALNNPRKKLCPKLEKNVKIKPNIIIFLFKERLIIYEL |
| Ga0247592_11370651 | 3300026500 | Seawater | WVILNSFLIGALNNPRKKLCPKLEKNVNMKPNIITFLFNERLIIYEL |
| Ga0209036_10875972 | 3300027702 | Marine | PWVIPNSFLIGALNNPKKKLCPKLEKNVNIKPNIITFLFIERLIIYEL |
| Ga0209711_100994923 | 3300027788 | Marine | SFLIGALNNPKKKLCPKLEKNVNINPNIIIFLFKERLIIYEF |
| Ga0209711_103748192 | 3300027788 | Marine | FLIGALNKPRKKLCPKLEKNVNIKPNIIIFLFRERFIIYEL |
| Ga0209711_104356081 | 3300027788 | Marine | NKPRKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL |
| Ga0209830_101077851 | 3300027791 | Marine | SFLIGALNNPKKKLCPKLEKNVNIKPYIITFLFNERLIIYEL |
| Ga0209090_105780691 | 3300027813 | Marine | NSPRKKLCPKLEKNVNIKPNIIIFLFKERLFIYEL |
| Ga0209712_102950361 | 3300027849 | Marine | IPSSFLIGALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYE |
| Ga0209712_104319571 | 3300027849 | Marine | LNNPKKKLCPKLEKNVNIKPNIITFLFNKRLIIYEL |
| Ga0228674_12132972 | 3300028008 | Seawater | PNCPWVIPNSFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0257110_10457971 | 3300028197 | Marine | ALNNPRKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0257126_12682032 | 3300028287 | Marine | PWVISNSFLIGALNNPKKKLCPKLEKNVKIKPNIITFLFNERLIIYE |
| Ga0307488_105754831 | 3300031519 | Sackhole Brine | SSFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFKERLIIYEL |
| Ga0308019_102821691 | 3300031598 | Marine | LIGALNNPKKKLCPKLEKNVNMKPNIITFLFKERLIIYEL |
| Ga0308004_101643881 | 3300031630 | Marine | GALNKPRKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL |
| Ga0308001_100565891 | 3300031644 | Marine | VISSSFLIGALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYE |
| Ga0308001_100763191 | 3300031644 | Marine | ALNKPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL |
| Ga0308016_100425201 | 3300031695 | Marine | LNKPKKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0308016_101806591 | 3300031695 | Marine | GALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYEL |
| Ga0307995_12681981 | 3300031696 | Marine | XVIPSSFLIGALNKPKKKLCPKLEKNVNMKPNIIIFLFKERLIIYEL |
| Ga0308013_100570881 | 3300031721 | Marine | PSSFLIGALNNPKKKLCPKLEKNVNIKPNIIIFLFKERLIIYE |
| Ga0308013_102337821 | 3300031721 | Marine | GALNNPKKKLCPKLEKNVNIKPNITTFLFNERLIIYEL |
| Ga0308013_103485081 | 3300031721 | Marine | GALNNPKKKLCPKLEKNVNMKPNNIIFLFKKRLVIYEL |
| Ga0315322_103129883 | 3300031766 | Seawater | SFLIGALNNPKKKLCPKLEKNVKINPNIITFLFKERLIIYEL |
| Ga0315332_108236961 | 3300031773 | Seawater | LNNPRKKLCPKLEKNVNIKPNIITFLLKESLIIYEL |
| Ga0315326_103797452 | 3300031775 | Seawater | PWVIPNSFLIGALNNPRKKLCPKLEKNVNIKPNIITFLFNERLIIYEL |
| Ga0315316_109628562 | 3300032011 | Seawater | PNWPCVIPSSFLIGALNNPKKKLCPKLEKNVKINPNIITFLFKERLIIYEL |
| Ga0315330_106968602 | 3300032047 | Seawater | GALNNPRKKLCPKLEKNVNIKPNIITFLFKERLIIYEL |
| Ga0315315_112403101 | 3300032073 | Seawater | LNNPRKKLCPKLEKNVNINPNIITFLFKVRLIIYDL |
| Ga0315315_112921782 | 3300032073 | Seawater | FLIGALNNPKKKLCPKLEKNVNIKPNIITFLFKVRLIINEL |
| ⦗Top⦘ |