Scaffold Ga0164290_1000753

Overview

Basic Information

• Taxon OID: 3300012921
• Scaffold ID: Ga0164290_1000753
• Source Dataset Name: Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 83300
• Total Scaffold Genes: 94
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 74 (78.72%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture → Genome Sequencing Of Microcoleus Cyanobacteria Isolates From Utah, Usa

Source Dataset Sampling Location

• Location Name: USA: Moab, Utah
• Coordinates
  • Lat. (^o): 38.5733
  • Long. (^o): -109.5498

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104510	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164290_100075329	F104510	GGGGG	LTLHTDAQKLNWSMIGVIVALCIQAAALVFGLGGLTQRVTNLEKIVAPLSDGTLARLDERTKAMKDQLDRIEREGA*