| Basic Information | |
|---|---|
| Taxon OID | 3300012921 Open in IMG/M |
| Scaffold ID | Ga0164290_1000753 Open in IMG/M |
| Source Dataset Name | Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 83300 |
| Total Scaffold Genes | 94 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 74 (78.72%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture → Genome Sequencing Of Microcoleus Cyanobacteria Isolates From Utah, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Moab, Utah | |||||||
| Coordinates | Lat. (o) | 38.5733 | Long. (o) | -109.5498 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104510 | Metagenome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0164290_100075329 | F104510 | GGGGG | LTLHTDAQKLNWSMIGVIVALCIQAAALVFGLGGLTQRVTNLEKIVAPLSDGTLARLDERTKAMKDQLDRIEREGA* |
| ⦗Top⦘ |