| Basic Information | |
|---|---|
| Taxon OID | 3300012879 Open in IMG/M |
| Scaffold ID | Ga0160504_1003187 Open in IMG/M |
| Source Dataset Name | Enriched soil microbial communities from UW Madison campus, WI, USA - DID2937_E24_Xylan MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4876 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Madison, Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018299 | Metagenome / Metatranscriptome | 235 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0160504_10031874 | F018299 | AGGCGG | MVGDDLNVGTILSEQAFFLKSGVFSLVKLGETPLAGDDDLLSTGELEFTSSESFNSMGNVLFVKSDGVEDLVNLNSGDFTNGLTEGTSHTSLESIGTSAGKHLVNSEDVPRVNSASKMETFLTALLDQVLVGSNTSSFHGFGGDLFLFERNEVNTEGEFFDFSLLFTGIINSDSGIGDTSVITRLGERLATPVSVASSGSSSHFMTLFSLISIKLY* |
| ⦗Top⦘ |