Scaffold Ga0160467_100009

Overview

Basic Information

• Taxon OID: 3300012829
• Scaffold ID: Ga0160467_100009
• Source Dataset Name: Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 588364
• Total Scaffold Genes: 543
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 92 (16.94%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: USA: Madison, Wisconsin
• Coordinates
  • Lat. (^o): 43.073
  • Long. (^o): -89.4011

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021521	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160467_100009357	F021521	N/A	VASYLYRTAQPLILAAFLPWGGSVGAGRIRLAAAKVGGIMKRIKF*