Basic Information | |
---|---|
Taxon OID | 3300012752 Open in IMG/M |
Scaffold ID | Ga0157629_1093468 Open in IMG/M |
Source Dataset Name | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3044 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.099 | Long. (o) | -89.405 | Alt. (m) | Depth (m) | 7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001326 | Metagenome / Metatranscriptome | 721 | Y |
F082615 | Metagenome / Metatranscriptome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157629_10934681 | F082615 | AGGAG | MATSTYLSNPVVKVGAAIGSIVDITDQVSAATLTVTAEALEDTAFGSTSRTMTAGLFSNS |
Ga0157629_10934683 | F001326 | GGAG | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTFTVRALPQYLFVGIDTQGDLLYDYQVPIADQVLYAKTADDVSRTAASGTVANDPVCTWVTAAQVMSYLGITITNPSDDYTLLTQSVSAGNQFCYRRRQESGYIDSLTTSPGGDATLGTLMYCAALWRSRGSIEATYATFDGMGSAPQQSLTPIVKQLLGFPRPAVA* |
⦗Top⦘ |