Scaffold Ga0157216_10019411

Overview

Basic Information

• Taxon OID: 3300012668
• Scaffold ID: Ga0157216_10019411
• Source Dataset Name: Arctic soils microbial communities. Combined Assembly of 23 SPs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3565
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Norway: Midre Lovenbreen, Svalbard
• Coordinates
  • Lat. (^o): 79.1005
  • Long. (^o): 12.15611
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072103	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157216_100194111	F072103	AGGAG	MSTILDTVVTYEDQLIDLVKKAKTPVVTYVAKGVELVSARIPAVTYPASLPTPIEVVESQVKFAKQLIDANTAIVTSVLETVAPIAGFAKPAKKVAKTVKAA*