Scaffold Ga0157497_1000061

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157497_1000061

Scaffold Ga0157497_1000061

Overview

Basic Information
Taxon OID	3300012664 Open in IMG/M
Scaffold ID	Ga0157497_1000061 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	24074
Total Scaffold Genes	30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location Name	Pefferlaw, Ontario
Coordinates	Lat. (^o)	44.25162	Long. (^o)	-79.2626	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038097	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157497_10000618	F038097	GGA	MIVISNKAGDIQLPQQEGLLEWLQERYPASKYHLVELA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.