Metagenome Family F038097

Overview

Basic Information

• Family ID: F038097
• Family Type: Metagenome
• Number of Sequences: 166
• Average Sequence Length: 38 residues
• Representative Sequence: MMYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT
• Number of Associated Samples: 105
• Number of Associated Scaffolds: 166

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 75.30 %
• % of genes near scaffold ends (potentially truncated): 9.64 %
• % of genes from short scaffolds (< 2000 bps): 43.37 %
• Associated GOLD sequencing projects: 95
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (42.771 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (26.506 % of family members)
• Environment Ontology (ENVO): Unclassified (80.723 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (83.133 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 16.67%
  β-sheet: 16.67%
  Coil/Unstructured: 66.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 166 Family Scaffolds
PF01227	GTP_cyclohydroI	24.70
PF01027	Bax1-I	9.04
PF01230	HIT	7.23
PF01370	Epimerase	4.22
PF13394	Fer4_14	3.01
PF04055	Radical_SAM	2.41
PF01242	PTPS	1.81
PF01041	DegT_DnrJ_EryC1	1.81
PF13671	AAA_33	1.81
PF02739	5_3_exonuc_N	1.81
PF14743	DNA_ligase_OB_2	1.20
PF00782	DSPc	1.20
PF00004	AAA	1.20
PF13517	FG-GAP_3	1.20
PF03819	MazG	1.20
PF12708	Pectate_lyase_3	0.60
PF10431	ClpB_D2-small	0.60
PF01648	ACPS	0.60
PF00462	Glutaredoxin	0.60
PF01503	PRA-PH	0.60
PF00082	Peptidase_S8	0.60
PF04325	DUF465	0.60
PF00574	CLP_protease	0.60
PF02915	Rubrerythrin	0.60
PF03721	UDPG_MGDP_dh_N	0.60
PF01467	CTP_transf_like	0.60
PF11351	GTA_holin_3TM	0.60
PF09414	RNA_ligase	0.60
PF14235	DUF4337	0.60
PF07724	AAA_2	0.60
PF02592	Vut_1	0.60
PF00011	HSP20	0.60
PF00118	Cpn60_TCP1	0.60
PF00156	Pribosyltran	0.60
PF00383	dCMP_cyt_deam_1	0.60
PF09834	DUF2061	0.60
PF13203	DUF2201_N	0.60
PF01555	N6_N4_Mtase	0.60
PF00730	HhH-GPD	0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 166 Family Scaffolds
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	1.81
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	1.81
COG0720	6-pyruvoyl-tetrahydropterin synthase	Coenzyme transport and metabolism [H]	1.81
COG0258	5'-3' exonuclease Xni/ExoIX (flap endonuclease)	Replication, recombination and repair [L]	1.81
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	1.81
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	1.81
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	1.81
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	1.81
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.20
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.20
COG1059	Thermostable 8-oxoguanine DNA glycosylase	Replication, recombination and repair [L]	0.60
COG0122	3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase	Replication, recombination and repair [L]	0.60
COG2231	3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily	Replication, recombination and repair [L]	0.60
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.60
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.60
COG1738	Queuosine precursor transporter YhhQ, DUF165 family	Translation, ribosomal structure and biogenesis [J]	0.60
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.60
COG1194	Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs	Replication, recombination and repair [L]	0.60
COG0177	Endonuclease III	Replication, recombination and repair [L]	0.60
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.60
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.60
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.60
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.60
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.60
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.60
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.60
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	0.60

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.23 %
Unclassified	root	N/A	42.77 %

Level 2

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	50.60 %
Unclassified	root	N/A	42.77 %
cellular organisms	root	All Organisms → cellular organisms	6.63 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	41.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	6.63 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	41.57 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.60 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	40.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.60 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	40.96 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.60 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	33.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	2.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1.20 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.60 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Vibrio phage 2.275.O._10N.286.54.E11	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	2.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Ackermannviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae	1.20 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.60 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Vibrio phage 2.275.O._10N.286.54.E11	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	2.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
unclassified Ackermannviridae	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae	1.20 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.60 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.77 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	9.04 %
Vibrio phage 2.275.O._10N.286.54.E11	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	2.41 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.81 %
Rhizobium phage RHph_I1_18	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18	1.20 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.60 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000101|DelMOSum2010_c10185244	Not Available	716
3300000736|JGI12547J11936_1092858	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	550
3300002144|M2t2BS2_10483637	Not Available	780
3300002408|B570J29032_109313955	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686
3300002408|B570J29032_109632948	Not Available	966
3300002835|B570J40625_101206170	Not Available	633
3300004128|Ga0066180_10236215	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	712
3300004128|Ga0066180_10283845	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	650
3300005581|Ga0049081_10000099	Not Available	32732
3300005581|Ga0049081_10329747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521
3300005582|Ga0049080_10016044	All Organisms → cellular organisms → Bacteria → Proteobacteria	2605
3300005584|Ga0049082_10023537	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2140
3300005585|Ga0049084_10291310	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543
3300005662|Ga0078894_11538544	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	551
3300005805|Ga0079957_1143784	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1223
3300005912|Ga0075109_1228104	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	570
3300005913|Ga0075108_10015223	Not Available	3012
3300005931|Ga0075119_1056538	All Organisms → cellular organisms → Bacteria	959
3300006071|Ga0007876_1000197	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25351
3300006071|Ga0007876_1013740	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2316
3300006071|Ga0007876_1107092	Not Available	719
3300006100|Ga0007806_1005209	Not Available	3367
3300006127|Ga0007805_1027035	Not Available	1314
3300007516|Ga0105050_10000136	Not Available	94984
3300007516|Ga0105050_10025520	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5060
3300008107|Ga0114340_1270739	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	504
3300008110|Ga0114343_1006982	Not Available	5830
3300008267|Ga0114364_1001643	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13261
3300008267|Ga0114364_1001883	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	12251
3300008267|Ga0114364_1176137	Not Available	552
3300009068|Ga0114973_10003186	Not Available	11678
3300009068|Ga0114973_10664225	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	532
3300009151|Ga0114962_10007487	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8296
3300009151|Ga0114962_10100403	Not Available	1803
3300009155|Ga0114968_10006116	Not Available	8882
3300009155|Ga0114968_10006731	Not Available	8459
3300009155|Ga0114968_10015012	Not Available	5452
3300009158|Ga0114977_10046188	Not Available	2704
3300009158|Ga0114977_10059767	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	2347
3300009158|Ga0114977_10133311	Not Available	1489
3300009159|Ga0114978_10000005	Not Available	179875
3300009159|Ga0114978_10000692	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	28512
3300009159|Ga0114978_10002244	Not Available	15932
3300009159|Ga0114978_10003883	Not Available	12186
3300009159|Ga0114978_10032786	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3697
3300009159|Ga0114978_10753722	Not Available	552
3300009161|Ga0114966_10053041	Not Available	2872
3300009163|Ga0114970_10004291	Not Available	10389
3300009163|Ga0114970_10033949	All Organisms → Viruses → Predicted Viral	3376
3300009163|Ga0114970_10099214	All Organisms → Viruses → Predicted Viral	1804
3300009164|Ga0114975_10083497	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	1857
3300009164|Ga0114975_10217742	All Organisms → Viruses → Predicted Viral	1075
3300009164|Ga0114975_10259473	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	970
3300009183|Ga0114974_10001208	Not Available	20485
3300009183|Ga0114974_10033161	All Organisms → cellular organisms → Bacteria	3551
3300009419|Ga0114982_1156407	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	704
3300010160|Ga0114967_10300067	Not Available	825
3300010334|Ga0136644_10343584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	856
3300010885|Ga0133913_10083181	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8583
3300010885|Ga0133913_10235933	All Organisms → cellular organisms → Bacteria	4861
3300010885|Ga0133913_11474715	All Organisms → Viruses → Predicted Viral	1725
3300012347|Ga0157142_1001784	All Organisms → cellular organisms → Bacteria	4894
3300012352|Ga0157138_1004101	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2477
3300012663|Ga0157203_1000018	Not Available	68771
3300012664|Ga0157497_1000061	Not Available	24074
3300012664|Ga0157497_1001105	All Organisms → cellular organisms → Bacteria	5078
3300012665|Ga0157210_1004745	All Organisms → Viruses → Predicted Viral	2854
3300012667|Ga0157208_10006214	All Organisms → Viruses → Predicted Viral	1848
3300013004|Ga0164293_10007687	Not Available	9113
3300013004|Ga0164293_10014092	Not Available	6716
3300013004|Ga0164293_10019064	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5729
3300013004|Ga0164293_10056926	Not Available	3128
3300013004|Ga0164293_10096242	Not Available	2282
3300013004|Ga0164293_10297047	Not Available	1121
3300013005|Ga0164292_10065400	Not Available	2816
3300013005|Ga0164292_10208764	Not Available	1384
3300013006|Ga0164294_10003564	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13821
3300013093|Ga0164296_1034084	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2748
(restricted) 3300013131|Ga0172373_10000715	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	54729
3300013372|Ga0177922_10547179	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2382
3300017722|Ga0181347_1017632	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2272
3300017722|Ga0181347_1033886	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1585
3300017736|Ga0181365_1142740	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569
3300017754|Ga0181344_1013193	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2624
3300017774|Ga0181358_1186518	Not Available	687
3300017777|Ga0181357_1074272	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1305
3300017777|Ga0181357_1222008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	666
3300017778|Ga0181349_1038208	All Organisms → Viruses → Predicted Viral	1912
3300019784|Ga0181359_1000195	Not Available	12767
3300019784|Ga0181359_1008337	All Organisms → cellular organisms → Bacteria	3577
3300019784|Ga0181359_1011731	All Organisms → Viruses → Predicted Viral	3154
3300019784|Ga0181359_1105722	All Organisms → Viruses → Predicted Viral	1026
3300020141|Ga0211732_1609528	Not Available	751
3300020151|Ga0211736_10338650	All Organisms → Viruses → Predicted Viral	2123
3300020159|Ga0211734_10868594	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2051
3300020160|Ga0211733_10385749	All Organisms → Viruses → Predicted Viral	1134
3300020160|Ga0211733_10404096	All Organisms → Viruses → Predicted Viral	1747
3300020160|Ga0211733_10445882	Not Available	4455
3300020160|Ga0211733_11118741	Not Available	14435
3300020160|Ga0211733_11216232	Not Available	3039
3300020161|Ga0211726_10190940	Not Available	859
3300020161|Ga0211726_10383946	Not Available	6548
3300020161|Ga0211726_10654849	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1197
3300020161|Ga0211726_10884809	Not Available	3357
3300020161|Ga0211726_10936406	All Organisms → Viruses → Predicted Viral	1481
3300020172|Ga0211729_10911171	Not Available	2831
3300020498|Ga0208050_1006695	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1383
3300020560|Ga0208852_1019090	Not Available	1322
3300020735|Ga0214219_1018716	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1168
3300021956|Ga0213922_1014121	All Organisms → cellular organisms → Bacteria → Proteobacteria	2141
3300022407|Ga0181351_1005674	Not Available	4771
3300022407|Ga0181351_1158789	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	804
3300023174|Ga0214921_10021511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6845
3300023174|Ga0214921_10146474	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18	1617
3300023184|Ga0214919_10000005	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	352754
3300023184|Ga0214919_10000941	Not Available	49223
3300025358|Ga0208504_1004088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2398
3300025369|Ga0208382_1031205	Not Available	665
3300025379|Ga0208738_1007500	Not Available	1958
3300025383|Ga0208250_1000196	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	20784
3300025392|Ga0208380_1003209	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3381
3300025467|Ga0208260_1057678	Not Available	798
3300025502|Ga0208903_1012732	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2851
3300025606|Ga0207954_1071036	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	903
3300025723|Ga0208741_10003843	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4884
3300027708|Ga0209188_1010088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5412
3300027710|Ga0209599_10210898	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	526
3300027720|Ga0209617_10086385	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1276
(restricted) 3300027728|Ga0247836_1050659	Not Available	2395
(restricted) 3300027728|Ga0247836_1062388	Not Available	2035
3300027733|Ga0209297_1006794	Not Available	5768
3300027734|Ga0209087_1001359	Not Available	14400
3300027736|Ga0209190_1016620	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4206
3300027754|Ga0209596_1004063	Not Available	11271
3300027759|Ga0209296_1052854	All Organisms → cellular organisms → Bacteria → Proteobacteria	2109
3300027763|Ga0209088_10010752	All Organisms → Viruses → Predicted Viral	4943
3300027782|Ga0209500_10004459	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9256
3300027782|Ga0209500_10010210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5819
3300027782|Ga0209500_10253926	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	765
3300027963|Ga0209400_1029002	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3105
3300027969|Ga0209191_1000387	Not Available	34786
3300027971|Ga0209401_1005006	Not Available	8094
3300027971|Ga0209401_1118440	Not Available	1070
(restricted) 3300027977|Ga0247834_1170747	Not Available	854
(restricted) 3300027977|Ga0247834_1241379	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	655
(restricted) 3300028571|Ga0247844_1024721	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4488
3300031857|Ga0315909_10061952	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	3395
3300031857|Ga0315909_10241088	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1396
3300031857|Ga0315909_10895171	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	548
3300032092|Ga0315905_10105420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2841
3300033993|Ga0334994_0372737	Not Available	699
3300033996|Ga0334979_0283779	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Ackermannviridae → unclassified Ackermannviridae → Rhizobium phage RHph_I1_18	946
3300034013|Ga0334991_0038932	All Organisms → cellular organisms → Bacteria	2578
3300034062|Ga0334995_0054350	Not Available	3250
3300034066|Ga0335019_0001730	Not Available	14269
3300034082|Ga0335020_0076439	Not Available	1725
3300034082|Ga0335020_0099340	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1485
3300034093|Ga0335012_0026630	All Organisms → Viruses → Predicted Viral	3413
3300034093|Ga0335012_0042888	Not Available	2633
3300034102|Ga0335029_0019285	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5203
3300034102|Ga0335029_0098754	Not Available	2063
3300034102|Ga0335029_0493555	Not Available	712
3300034102|Ga0335029_0557098	Not Available	652
3300034272|Ga0335049_0178520	Not Available	1504
3300034283|Ga0335007_0240286	Not Available	1227
3300034284|Ga0335013_0132355	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1713

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.80%
Terrestrial	Environmental → Terrestrial	1.20%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	95.18%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	2.41%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.20%
Marine	Environmental → Aquatic → Marine	0.60%
Unclassified	Environmental → Aquatic → Unclassified	0.60%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	60.84%
Lentic	Environmental → Aquatic → Freshwater → Lentic	25.90%
Lotic	Environmental → Aquatic → Freshwater → Lotic	4.22%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.41%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	2.41%
Ice	Environmental → Aquatic → Freshwater → Ice	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.20%
Creek	Environmental → Aquatic → Freshwater → Creek	0.60%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.60%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.60%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	60.84%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	22.29%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	4.22%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.01%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.41%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	2.41%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.20%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.60%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.60%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	26.51%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	21.69%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	10.24%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	9.04%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.04%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	4.22%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	3.01%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	3.01%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.41%
Saline Lake	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake	2.41%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.81%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	1.20%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	1.20%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.20%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	0.60%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.60%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.60%
Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine	0.60%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.60%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300000101	Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010	Environmental
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental
3300002144	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)	Environmental
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental
3300004128	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental
3300005912	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD	Environmental
3300005913	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1	Environmental
3300005931	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9	Environmental
3300006071	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09	Environmental
3300006100	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09	Environmental
3300006127	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09	Environmental
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300012347	Freshwater microbial communities from Fish Creek, Ontario, Canada - S48	Environmental
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental
3300012664	Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17	Environmental
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental
3300012667	Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15	Environmental
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental
3300013093	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG	Environmental
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental
3300020560	Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)	Environmental
3300020735	Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion	Environmental
3300021956	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG	Environmental
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental
3300025358	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)	Environmental
3300025369	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)	Environmental
3300025379	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes)	Environmental
3300025383	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes)	Environmental
3300025392	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)	Environmental
3300025467	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes)	Environmental
3300025502	Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes)	Environmental
3300025606	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes)	Environmental
3300025723	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)	Environmental
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental
3300027720	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)	Environmental
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental
3300027763	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)	Environmental
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental
3300027977 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m	Environmental
3300028571 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1	Environmental
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental
3300034272	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156	Environmental
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental
3300034284	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
DelMOSum2010_101852442	3300000101	Marine	MRYYITNKQGTVNLPYEPGLIEWLQEHYPVSKYRIVEVV*
JGI12547J11936_10928581	3300000736	Freshwater And Sediment	MYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT*
M2t2BS2_104836374	3300002144	Marine	MIKYITNKSGTINLPWEPGMLEWLRERYPASQYRVVEVA*
B570J29032_1093139553	3300002408	Freshwater	MMYITNITGEIKLPWEPGLLEWLHENYPASKYRVVELT*
B570J29032_1096329483	3300002408	Freshwater	MTIITNITGEINLPWEPGLLEWLQEHYPASKYRVVELT*
B570J40625_1012061701	3300002835	Freshwater	MIYITNRDGSIKLPWEPDLLEWLQEQYPYSQYHLAELDKITQ*
Ga0066180_102362151	3300004128	Freshwater Lake	KMTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0066180_102838451	3300004128	Freshwater Lake	KMTIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT*
Ga0049081_100000995	3300005581	Freshwater Lentic	MKYITNITGEIKLPWEPGLLEWLQEQYPASKYRIVESI*
Ga0049081_103297473	3300005581	Freshwater Lentic	ITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0049080_100160444	3300005582	Freshwater Lentic	MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0049082_100235372	3300005584	Freshwater Lentic	MTIITNITGKIKLPWEPGLLEWLQEQYPASQYRVVELT*
Ga0049084_102913103	3300005585	Freshwater Lentic	MIYITNITGEIKLPWEPGLLEWLQEQYPASKYRVVELT*
Ga0078894_115385442	3300005662	Freshwater Lake	MKIIVNKAGDIQLPWEPGLLAWLQERYPASKYQEVIL*
Ga0079957_11437841	3300005805	Lake	MMIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVKLTRGKQNE*
Ga0075109_12281042	3300005912	Saline Lake	MIYIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA*
Ga0075108_100152238	3300005913	Saline Lake	MKYYIANKSGTINLPWEPGLVEWLQEKYPASQYRVVEAV*
Ga0075119_10565383	3300005931	Saline Lake	YIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA*
Ga0007876_100019728	3300006071	Freshwater	MYITNCTGEIRLPNEPGLLEWLQENYPYSKYRLVNV*
Ga0007876_10137405	3300006071	Freshwater	MYITERTGTIRLPAEPGLLEWLQSQYPYSKYRLVQE*
Ga0007876_11070923	3300006071	Freshwater	MYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELF*
Ga0007806_10052099	3300006100	Freshwater	MYITNRTGEIRLPNEPGLLAWLQDTYPYSQYHIVNDE*
Ga0007805_10270353	3300006127	Freshwater	MKFILNKAGNIKLPYEPGLLEWLQEKYPASQYRIIYD*
Ga0105050_1000013655	3300007516	Freshwater	MKYITNKSGTINLPWEPGLLEWLRENYPASDYRIVGIEYEYV*
Ga0105050_100255201	3300007516	Freshwater	MKYYIANKSGTINLPWEPGLVEWLQERYPASQYRVVEVA*
Ga0114340_12707391	3300008107	Freshwater, Plankton	MYITNITGEIKLPWEPGLLEWLQENYPASKYRVLELT*
Ga0114343_10069828	3300008110	Freshwater, Plankton	MNYIRNRAGTVVLPEEPGLLEWLQTQYPFSQYYVVEVSNGM*
Ga0114364_100164311	3300008267	Freshwater, Plankton	MIYITNRDGSIKLPWEPDLLEWLQQQYPYSQYRLAELDKNTQ*
Ga0114364_100188325	3300008267	Freshwater, Plankton	MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNTQ*
Ga0114364_11761371	3300008267	Freshwater, Plankton	MIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT*
Ga0114973_1000318612	3300009068	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQEHYPASQYKVVELT*
Ga0114973_106642251	3300009068	Freshwater Lake	MSIKYITNKSKTVNLPWEPGLLEWLNEHYPYSKYYEVELK*
Ga0114962_100074876	3300009151	Freshwater Lake	MRVIVNKAGNIRLPWEPGLLEWLQEQYPYSQYRIVESTR*
Ga0114962_101004033	3300009151	Freshwater Lake	MMYITNITGEIKLPWEPGLLEWLHENYPASKYKVVELT*
Ga0114968_1000611614	3300009155	Freshwater Lake	MKIIVNKFNTIQLPWEPGLLEWLNEHYPYSKYYEVELT*
Ga0114968_1000673112	3300009155	Freshwater Lake	MIIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI*
Ga0114968_100150129	3300009155	Freshwater Lake	MYITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT*
Ga0114977_100461882	3300009158	Freshwater Lake	MYITNRTGEINLPWEPGLLEWLQEHYPASRYRVVELT*
Ga0114977_100597673	3300009158	Freshwater Lake	MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVIL*
Ga0114977_101333112	3300009158	Freshwater Lake	MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVTL*
Ga0114978_10000005116	3300009159	Freshwater Lake	MKYITNITGEIKLPWEPGLLEWLQEQYPYSKYRVVEEHQDEEISQLVG*
Ga0114978_100006925	3300009159	Freshwater Lake	MIYITNCDGSINLPWEPDLLEWLQTQYPYSKYRIVETS*
Ga0114978_100022444	3300009159	Freshwater Lake	MIYITNITGEIQLPWEPGLLEWLHENYPASKYYIKEI*
Ga0114978_1000388319	3300009159	Freshwater Lake	MIYITNRDGSINLPWEPDLLEWLQEHYPYSQYRLAQTS*
Ga0114978_100327865	3300009159	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0114978_107537222	3300009159	Freshwater Lake	MKYITNITGEIKLPWEPGLLEWLQEKYPASKYHIVEII*
Ga0114966_100530412	3300009161	Freshwater Lake	MTIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI*
Ga0114970_100042912	3300009163	Freshwater Lake	MYITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0114970_100339492	3300009163	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQENYPASKYRVVELT*
Ga0114970_100992145	3300009163	Freshwater Lake	MKIISSYDGSINLPWEPGLLEWLHVHYPYSKYRIVEVEHEV*
Ga0114975_100834974	3300009164	Freshwater Lake	MRIITNRSGDIQFPWEPGLLEWLQERYPASKYQEVTL*
Ga0114975_102177421	3300009164	Freshwater Lake	KMTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT*
Ga0114975_102594732	3300009164	Freshwater Lake	MRIITNQSRDIQLPWEPGLLEWLQERYPASKYQEIIV*
Ga0114974_100012088	3300009183	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT*
Ga0114974_100331617	3300009183	Freshwater Lake	MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT*
Ga0114982_11564073	3300009419	Deep Subsurface	MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVMV*
Ga0114967_103000673	3300010160	Freshwater Lake	MRIITNRSGDIQFLWEPGLLEWLQERYPASKYQEVIL*
Ga0136644_103435842	3300010334	Freshwater Lake	MIRYIINKAGNIKVPWEPGLLEWLQERYPYSQYTIIETIK*
Ga0133913_100831814	3300010885	Freshwater Lake	MYITNRTGDITLPWEPGLLEWLQEQYPYSKYKVVETLAF*
Ga0133913_102359338	3300010885	Freshwater Lake	MIIISDRTGNIQLPAEPGLLEWLQEHYPYSQYYLTTK*
Ga0133913_114747156	3300010885	Freshwater Lake	KRYIRNHTGEIRLPWEPGLLEWLQEQYPVSQYRVVELT*
Ga0157142_10017842	3300012347	Freshwater	MIVISNKTGDIQLPYQEGLLEWLQEHYPASKYYLVELA*
Ga0157138_10041013	3300012352	Freshwater	MYITNKFDSIRLPVEPGLLEWLQETYPKSEYRVVEV*
Ga0157203_100001837	3300012663	Freshwater	MKYITNKYDSIRLPVEPGLLEWLQENYPASKYHEVEL*
Ga0157497_10000618	3300012664	Freshwater	MIVISNKAGDIQLPQQEGLLEWLQERYPASKYHLVELA*
Ga0157497_10011058	3300012664	Freshwater	MIIITNKTGDIQLPNQEGLLEWLQERYPASKYHLVELA*
Ga0157210_10047454	3300012665	Freshwater	MFKYITNKYGSVKFPVEPGLLEWLLEQYPHSEYRIVEIA*
Ga0157208_100062143	3300012667	Freshwater	MIIISNKTGEIQLPYQEGLLEWLQERYPASKYHLVELA*
Ga0164293_100076876	3300013004	Freshwater	MTIITNITGEIKLPWEPGLLEWLQENYPASQYRVVELT*
Ga0164293_100140926	3300013004	Freshwater	MTIITNITGEIQLPWEPGLLEWLQEHYPASQYRVVELT*
Ga0164293_100190649	3300013004	Freshwater	MMYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEI*
Ga0164293_100569262	3300013004	Freshwater	MIYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT*
Ga0164293_100962422	3300013004	Freshwater	MRIITNQAGDIQLPWEPGLLEWLQERYPASKYQEITL*
Ga0164293_102970472	3300013004	Freshwater	MIYITNCDGSINLPWEPDLLEWLQEHYPYSKYRLAETS*
Ga0164292_100654006	3300013005	Freshwater	MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELT*
Ga0164292_102087643	3300013005	Freshwater	MTIITNRTGEINLPWEPGLLEWLQEHYPASKYRVVELT*
Ga0164294_1000356413	3300013006	Freshwater	MIYITNRDGTINLPWEPDLLEWLQTQYPYSKYRIVETS*
Ga0164296_10340845	3300013093	Freshwater	MYITNRTGDIRLPNEPGLLEWLQDTYPYSQYHIVNDE*
(restricted) Ga0172373_1000071534	3300013131	Freshwater	MIITNRTGKIRLPWEPGLLEWLQEHYPASQYRVVELT*
Ga0177922_105471795	3300013372	Freshwater	MTIITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT*
Ga0181347_10176323	3300017722	Freshwater Lake	MYITNITGEIKLPWEPGLLEWLQENYPASKYRVLELT
Ga0181347_10338862	3300017722	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRIVENTNT
Ga0181365_11427401	3300017736	Freshwater Lake	GVCTEMTIITNITGEIKLPWESGLLEWLQEQYPASQYRVVELT
Ga0181344_10131935	3300017754	Freshwater Lake	MIVISNKAGDIQLPQQEGLLEWLQERYPASKYHLVELA
Ga0181358_11865183	3300017774	Freshwater Lake	MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNT
Ga0181357_10742722	3300017777	Freshwater Lake	MYITNRTGEINLPWEPGLLEWLQENYPASQYKIVENTNT
Ga0181357_12220081	3300017777	Freshwater Lake	IITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT
Ga0181349_10382084	3300017778	Freshwater Lake	MIIISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI
Ga0181359_100019518	3300019784	Freshwater Lake	MIIITNITGEIQFHWEPGLLEWLQEHYPASQYRVVELT
Ga0181359_10083373	3300019784	Freshwater Lake	MTIITNITGEIKLPWESGLLEWLQEQYPASQYRVVELT
Ga0181359_10117313	3300019784	Freshwater Lake	MTIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT
Ga0181359_11057223	3300019784	Freshwater Lake	MIYITNRDGTINLPWEPDLLEWLQVQYPYSQYRLVELDKNTQ
Ga0211732_16095282	3300020141	Freshwater	MYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT
Ga0211736_103386503	3300020151	Freshwater	MTIITNITGEIRLPWEPGLLEWLQEHYPASKYRVVELT
Ga0211734_108685942	3300020159	Freshwater	MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELS
Ga0211733_103857491	3300020160	Freshwater	ITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT
Ga0211733_104040962	3300020160	Freshwater	MYITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT
Ga0211733_1044588210	3300020160	Freshwater	MKYITNITGEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIFQLVR
Ga0211733_111187412	3300020160	Freshwater	MKYITNITGEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIS
Ga0211733_112162322	3300020160	Freshwater	MIYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT
Ga0211726_101909401	3300020161	Freshwater	MIYITNRDGSIKLPWEPDLLEWLQEHYPYSQYQLAETS
Ga0211726_103839469	3300020161	Freshwater	MIIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVELT
Ga0211726_106548491	3300020161	Freshwater	MMYITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT
Ga0211726_108848097	3300020161	Freshwater	MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRVVELT
Ga0211726_109364062	3300020161	Freshwater	MMYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEQ
Ga0211729_109111712	3300020172	Freshwater	MIITNITGEIKLPWEPGLLEWLQEHYPASQYRVVELT
Ga0208050_10066952	3300020498	Freshwater	MYITNRTGKIKLPWEPGLLEWLQEHYPASQYRVVELT
Ga0208852_10190904	3300020560	Freshwater	MKYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVERFQDEKVS
Ga0214219_10187165	3300020735	Freshwater	KMYITNRTGEIRLPNEPGLLAWLQDTYPYSQYHIVNDE
Ga0213922_10141217	3300021956	Freshwater	MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVTI
Ga0181351_10056743	3300022407	Freshwater Lake	MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELT
Ga0181351_11587891	3300022407	Freshwater Lake	CTKMIIITNITGEIQFHWEPGLLEWLQEHYPASQYRVVELT
Ga0214921_100215112	3300023174	Freshwater	MTIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT
Ga0214921_101464742	3300023174	Freshwater	MTIITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT
Ga0214919_10000005152	3300023184	Freshwater	MIIITNYTRDIQLPYEEGLLEWLQQQYPASKYQLVELE
Ga0214919_1000094161	3300023184	Freshwater	MIIITNITGDIRLPWEPGLLEWLQEQYPASQYRVVELT
Ga0208504_10040881	3300025358	Freshwater	MYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELF
Ga0208382_10312053	3300025369	Freshwater	MSIITNKYGNIRLPNEPGLLEWLNEHYPYSEYHVV
Ga0208738_10075005	3300025379	Freshwater	MKFILNKAGNIKLPYEPGLLEWLQEKYPASQYRIIYD
Ga0208250_100019621	3300025383	Freshwater	MYITNCTGEIRLPNEPGLLEWLQENYPYSKYRLVNV
Ga0208380_100320910	3300025392	Freshwater	MYITERTGTIRLPAEPGLLEWLQSQYPYSKYRLVQE
Ga0208260_10576781	3300025467	Freshwater	FYXGGDNMYITESTGTIKLPYEPGLLEWLQENYPYSKYRLIELFXNK
Ga0208903_10127323	3300025502	Saline Lake	MIYIASKSARINLPYEPGLLEWLQERYPASQYRVVEVA
Ga0207954_10710362	3300025606	Freshwater	MTIITNITGEIQLPWEPGLLEWLQEHYPASKYRVVELT
Ga0208741_100038436	3300025723	Freshwater	MYITESTNSIKLPYEPGLLEWLQEHYPFSKYRLVNL
Ga0209188_10100885	3300027708	Freshwater Lake	MRVIVNKAGNIRLPWEPGLLEWLQEQYPYSQYRIVESTR
Ga0209599_102108982	3300027710	Deep Subsurface	MKIIVNKAGNIQLPWEPGLLAWLQERYPASKYQEVMV
Ga0209617_100863853	3300027720	Freshwater And Sediment	MYITNITGEIKLPWEPGLLEWLQEHYPASKYRIVELT
(restricted) Ga0247836_10506592	3300027728	Freshwater	MIIITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVELKNVGS
(restricted) Ga0247836_10623883	3300027728	Freshwater	MMHITNITGEIKLPWEPGLLEWLQEHYPASQYRVAELT
Ga0209297_100679412	3300027733	Freshwater Lake	MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVIL
Ga0209087_100135923	3300027734	Freshwater Lake	MYITNRTGEINLPWEPGLLEWLQEHYPASRYRVVELT
Ga0209190_10166203	3300027736	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQENYPASKYRVVELT
Ga0209596_100406311	3300027754	Freshwater Lake	MYITNITGEIKLPWEPGLLEWLQENYPASKYRVVELT
Ga0209296_10528542	3300027759	Freshwater Lake	MIYITNITGEIQLPWEPGLLEWLHENYPASKYYIKEI
Ga0209088_100107526	3300027763	Freshwater Lake	MKYITNITGEIKLPWEPGLLEWLQEQYPYSKYRVVEEHQDEEISQLVG
Ga0209500_1000445912	3300027782	Freshwater Lake	MIYITNCDGSINLPWEPDLLEWLQTQYPYSKYRIVETS
Ga0209500_100102104	3300027782	Freshwater Lake	MIYITNRDGSINLPWEPDLLEWLQEHYPYSQYRLAQTS
Ga0209500_102539262	3300027782	Freshwater Lake	MRIITNRSGDIQLPWEPGLLEWLQERYPASKYQEVTL
Ga0209400_10290026	3300027963	Freshwater Lake	MKIIVNKFNTIQLPWEPGLLEWLNEHYPYSKYYEVELT
Ga0209191_100038739	3300027969	Freshwater Lake	MRIITNRTGDIQLPWEPGLLEWLQERYPASKYQEVTL
Ga0209401_10050062	3300027971	Freshwater Lake	MTIITNITGEIRLPWEPGLLEWLQEHYPASQYKVVELT
Ga0209401_11184403	3300027971	Freshwater Lake	MTVISDRTGNIQLPVEPGLLEWLQEHYPYSQYYLTTI
(restricted) Ga0247834_11707472	3300027977	Freshwater	MIITNITGEIRLPWEPGLLEWLQEHYPASQYRVVELT
(restricted) Ga0247834_12413791	3300027977	Freshwater	MYITNITGEIRLPWEPGLLEWLQEHYPASKYRIVELT
(restricted) Ga0247844_102472110	3300028571	Freshwater	ITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVELKNVGS
Ga0315909_100619524	3300031857	Freshwater	MTIITNCTGEINLPWEPGLLEWLQEHYPASKYRVIELT
Ga0315909_102410883	3300031857	Freshwater	MMIITNCTGEINLPWEPGLLEWLQEHYPASQYRVVELT
Ga0315909_108951712	3300031857	Freshwater	MKIIVNKAGDIQLPWEPGLLAWLQERYPASKYQEVIL
Ga0315905_101054201	3300032092	Freshwater	MIIITNHDGSIQFPWEPDLLEWLNENYPFSRYHLVDLQKVKQ
Ga0334994_0372737_31_147	3300033993	Freshwater	MMYITNITGEIKLPWEPGLLEWLHENYPASQYRVVELT
Ga0334979_0283779_44_154	3300033996	Freshwater	MYITNITGEIKLPWEPGLLEWLQENYPASKYYIKEI
Ga0334991_0038932_52_168	3300034013	Freshwater	MTIITNITGEIRLPWEPGLLEWLHENYPASQYRVVELT
Ga0334995_0054350_1604_1720	3300034062	Freshwater	MMYITNITGEIKLPWEPGLLEWLHENYPASKYRVVELT
Ga0335019_0001730_9982_10098	3300034066	Freshwater	MTIITNITGEIQLPWEPGLLEWLQEHYPASQYRVVELT
Ga0335020_0076439_1360_1473	3300034082	Freshwater	MRIITNQAGDIQLPWEPGLLEWLQERYPASKYQEITL
Ga0335020_0099340_479_601	3300034082	Freshwater	MMYITNITGEIKLPWEPGLLEWLHENYPASKYRIVENTNT
Ga0335012_0026630_2502_2615	3300034093	Freshwater	MKYITNRNGSIKLPWEPGLVEWLQKRYPLSQYQVVEK
Ga0335012_0042888_1273_1389	3300034093	Freshwater	MTIITNITGEINLPWEPGLLEWLQEHYPASKYRVVELT
Ga0335029_0019285_136_252	3300034102	Freshwater	MTIITNITGEIKLPWEPGLLEWLQEQYPASQYRVVELN
Ga0335029_0098754_143_289	3300034102	Freshwater	MKYITNITGEIKLPWEPGLLEWLQERYPASKYHTVEEYQDEEISQLVG
Ga0335029_0493555_574_708	3300034102	Freshwater	MKYITNITEEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEEIS
Ga0335029_0557098_169_303	3300034102	Freshwater	MKYITNITEEIKLPWEPGLLEWLQERYPASKYRIVEEYQDEKIS
Ga0335049_0178520_866_994	3300034272	Freshwater	MIYITNRDGTINLPWEPDLLEWLQERYPYSQYRLAELDKNTQ
Ga0335007_0240286_328_441	3300034283	Freshwater	MIITNRTGEINLPWEPGLLEWLQEHYPASQYRVVELT
Ga0335013_0132355_778_894	3300034284	Freshwater	MTIITNITGEIKLPWEPGLLEWLQENYPASQYRVVELT