| Basic Information | |
|---|---|
| Taxon OID | 3300012606 Open in IMG/M |
| Scaffold ID | Ga0118220_107636 Open in IMG/M |
| Source Dataset Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100507 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Pennsylvania |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 516 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F105149 | Metagenome / Metatranscriptome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118220_1076361 | F105149 | N/A | MHFYFEVTKISEISRKRNMLRRMYQGGSSAKNGPRIAIREQDVELPRDVDVRACEWPSDDFMVEAGFKEEFDAYVRNAELEDFLQDKCPQYYQLTDSFVRRFEYISLRNSPSVMFDIYDTSYTMDLEDFTTACKLPQWGNINDPRKSEFRDFLASITVGESRD |
| ⦗Top⦘ |