3300012606: Human skin bacterial and viral communities - University of Pennsylvania - MG100507

Overview

Basic Information

• IMG/M Taxon OID: 3300012606
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0118646 | Gp0138157 | Ga0118220
• Sample Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100507
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Pennsylvania
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 19912186
• Sequencing Scaffolds: 6
• Novel Protein Genes: 6
• Associated Families: 6

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	3
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Skin Bacterial And Viral Communities - University Of Pennsylvania
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011735	Metagenome / Metatranscriptome	287	Y
F020492	Metagenome	223	Y
F020828	Metagenome / Metatranscriptome	221	Y
F034384	Metagenome	175	Y
F076912	Metagenome	117	Y
F105149	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0118220_101083	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	1202
Ga0118220_103471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	734
Ga0118220_105842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	580
Ga0118220_107503	Not Available	520
Ga0118220_107636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis	516
Ga0118220_107675	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	515

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118220_101083	Ga0118220_1010832	F034384	VIVLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMNVFRLESRVAAVVDYLAKLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKFSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG*
Ga0118220_103471	Ga0118220_1034711	F076912	LGKSALLSNDKGSNADKVQDSDTSCLGLVLELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNIS*
Ga0118220_105842	Ga0118220_1058421	F020492	TAEVDTLKQNLEQSEQELGRAKKQLEDKEGKKYLV*
Ga0118220_107503	Ga0118220_1075031	F011735	PYIVKRKLAKGAYELIDFDGVPLDKPRNGLYLKRYYA*
Ga0118220_107636	Ga0118220_1076361	F105149	MHFYFEVTKISEISRKRNMLRRMYQGGSSAKNGPRIAIREQDVELPRDVDVRACEWPSDDFMVEAGFKEEFDAYVRNAELEDFLQDKCPQYYQLTDSFVRRFEYISLRNSPSVMFDIYDTSYTMDLEDFTTACKLPQWGNINDPRKSEFRDFLASITVGESRD
Ga0118220_107675	Ga0118220_1076751	F020828	SVSDAAAFYQAEEGRSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHHTPEMYYKSVLKGALTIAGECSKDVIFE*