Scaffold Ga0138256_10077231

Overview

Basic Information

• Taxon OID: 3300012533
• Scaffold ID: Ga0138256_10077231
• Source Dataset Name: Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3244
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria

Source Dataset Sampling Location

• Location Name: Austria: Klosterneuburg
• Coordinates
  • Lat. (^o): 48.3
  • Long. (^o): 16.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021521	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138256_100772311	F021521	N/A	LHRTAQPPTLAAFRPWEGSAGAGRVRPAGAKIRV*